CAZyme Information: MGYG000000886_00454

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_00454
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692		79558.17	6.7847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 76418; End: 78496 Strand: -

Full Sequence      

MEENNENLLEYYKDAYEREKSRNAELADELADANAKAADLYTQLNRIKGNPLWKLSKPFR
VVMHFFIRNYQRLAAHGNPRGIAHKIKSKMIEKRAMKQHGKRSFPNAKRRREEETTKFDR
DITISILVPLYNTPKKFLTEMIDSVVAQTYLKWELCLADGSDDAHGYVGKICEEYAQLDL
RIRYQKLESNEGISGNTNECYKMATGEYIGLFDHDDILHPSVLYEYMKAICEQDADYIYC
DEATFKNGNIDHMITLHFKPDYAIDNLRANNYICHFSVFSRELLEGTELFRSRFDGSQDH
DMILRLTSEAKHVVHVPKLLYYWRSHKGSVASDISAKTYAIEAARGAVADHLTRFGFEHF
KIESTRAFETIFRIRYQLTGQPQVSIIIPNKDHLTDLKRCIDSILDKSTYENYDIIVVEN
NSVTDEIFAYYEEIKKHPRIQVVTYEGEFNYSKINNFGAQFAQGEYLMLLNNDTQVITVN
WIEEMMMYGQREDVGVVGAKLYYEDMTIQHAGIVVGLGAHRTAGHTHYKVNKENVGYMGK
LCYAQDVSAVTGACMLVKKALYDELGGLSEEFAVALNDVDFCLRVREKGLLVVFTPFAEL
YHFESKSRGSDLKLSKKERAKLEKENAAKGKRSADGTAMDNSSRYNKEAALFRNKWKDIL
AKGDPYYNVNFSLDRSDYSLKLHKAGAEDTAV

Enzyme Prediction     

No EC number prediction in MGYG000000886_00454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	125	285	1.2e-25	0.9764705882352941
GT2	385	565	6.5e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.28e-80	124	324	3	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	9.45e-42	386	604	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.25e-28	380	610	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.51e-24	125	284	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.82e-18	126	276	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95572.1	6.12e-299	12	682	6	675
ADL33299.1	1.15e-298	12	682	6	673
QNM02106.1	1.63e-289	12	681	6	678
QUO22278.1	1.87e-284	43	682	17	630
CAB1243278.1	1.03e-245	1	681	369	1033

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.03e-115	124	680	368	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.01e-84	112	692	309	852	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	4.80e-13	124	330	5	221	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q58457	3.53e-11	124	305	10	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71054	1.11e-08	124	344	7	225	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000007	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_00454.