CAZyme Information: MGYG000000886_00463

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_00463
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695		81799.12	5.7318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 86114; End: 88201 Strand: -

Full Sequence      

MSNPIKQIIFDHQLKKCHRRYEKIVEEMRDPYKQWIVQNEPKKKPGEKDEYISKIEKLDF
SEFMNIIRKKKDAYECLPDGWFVICQGQGNYSMPVMEGRSVFSDYSGFGMAYADEDMVDP
ENGARYGAWFKPDYSPDTLMSFFYFGSIIFFRGVLVRRALISFQPAIPEEECSDRQYFYD
FMLFFTEFLENDSMRIKHIPQVLFHSIGEGYQPEDPKKPEVVNENVYWGYEPMYDACKLA
AIRRRGREAHMKEIVHAGRKYHVPVYHIEKDGRKPMVSIIIPSKNNADVLAVCLESLYER
TDYSDYEVIVVDNGSNEGNRRKVGLLQEKYGFRYLYEPMEFNFSKMCNLGFAASKGAYIM
LLNDDMEILQPDWLDVMVGQVLVDYVGAVGAKLLYPDSDLIQHAGITNLPVGPAHKLLKE
HDNIRDYYYGRNVLPYDVIGVTGACLLVSRTCYLETEKFCEDIAVSYNDVDFCFSLRDLG
YRNVVRNDVVLYHHESLSRGDDTMSDEKWDRLLHEKDIVYERHLHLKGKDPYYNPNLAGF
KHKYFCSYLYPYERRNCYNQVKPFKGKIKEEWHNDCLTVTLEHVRLERKLDLQEEQDVYW
LEGWAYVLNMDTSRYERSLVLIDESGSMYEASLHDRYRQDVEEILPEQTNVGLAGFSCRI
RRDELHPGEYTVALLYRDKCSRQRLYKECKEKLIV

Enzyme Prediction     

No EC number prediction in MGYG000000886_00463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	278	450	8e-21	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.45e-32	279	495	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.16e-24	275	549	3	271	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.99e-20	278	450	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.34e-16	279	394	1	119	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06423	CESA_like	6.43e-14	279	393	1	116	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVK48684.1	9.02e-114	106	686	810	1352
QUF73846.1	2.39e-113	106	686	810	1352
ABR36854.1	2.39e-113	106	686	810	1352
AIU02421.1	2.39e-113	106	686	810	1352
QNM02107.1	1.59e-103	1	686	3	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	1.22e-06	277	384	95	202	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.22e-06	277	384	94	201	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	9.90e-43	112	538	483	889	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.50e-31	110	538	434	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q8L0V4	6.99e-06	277	384	152	259	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_00463.