CAZyme Information: MGYG000000886_00736

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_00736
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000000886_3|CGC1	56289.04	4.6325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 68268; End: 69749 Strand: +

Full Sequence      

MENTQTHKFQNFQARIAEAEKHIAAVQNSRYALKLHLMPPVGWLNDPNGLCEKDGLYHIF
FQYSPFDAAGGDKFWGHYQTRDFIRYEYTGAPLAPDLPIDRDGVYSGCALVDDDVIKLYY
TGNVRDENTDGIMEGREANTVYAETKDGIAMSPKKCLMTNADYPSFVTCHVRDPKVWKED
GVYYMVQGAWSKDYKGYVLIFTSENGTDWRYRNFLTTEETFGYMWECPSLFSLNGKQVLS
VSPQGVESEEFRYQNIYQSGYFLLDGDFRGEYSLNNFYEWDMGFDFYAPQIFEDEKGRQI
LIGWMGIPDADYTNPTLTDGWQHTLTFPRELRLSSDGARILQSPLKELENLRKKQVLPTK
QSDGKTLYEGLSLYELLVDHITASLSLTIADDLHLDWDEAAGIFALSFTGSAGYGRTTRK
AKLDKLDNLQVFVDSSAIEVYLNKGELVFSSRFYPKSPCHDLWLQDGGFAISGGCSQTLW
ELSPITTTYDNKK

Enzyme Prediction     

No EC number prediction in MGYG000000886_00736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	36	344	2.7e-85	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	8.43e-154	42	333	1	287	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.61e-140	20	456	2	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.36e-128	9	458	5	462	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	3.56e-107	36	344	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	8.21e-101	36	445	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29305.1	3.93e-162	27	485	24	474
QEH67471.1	6.11e-160	26	456	23	454
ADZ81804.1	1.41e-158	26	456	23	454
QNM06260.1	7.84e-154	20	489	17	485
CED94068.1	2.06e-150	26	455	23	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.10e-71	11	464	5	468	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	3.57e-61	18	479	32	475	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.18e-60	18	479	32	475	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	1.93e-59	7	454	12	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
3PIG_A	3.31e-57	14	454	19	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	5.55e-109	18	462	15	461	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	6.40e-81	20	454	22	463	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	3.43e-77	36	454	41	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P16553	2.14e-76	20	483	13	476	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P27217	7.08e-70	25	458	21	442	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_00736.