CAZyme Information: MGYG000000886_01851

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_01851
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000000886_9|CGC2	45745.85	4.635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 107177; End: 108364 Strand: -

Full Sequence      

MNIKGVNLGNWLVLEKWMSPSLFEGTTAEDEYYLPTQLSGEVYEARIRTHRSEYITERDF
ATIRSWGMNAVRIPVPYFIFGDCPPFIGCVSELDKAFNWAEKYGLQILIDLHTVPGSQNG
FDNGGISGVCKWAQNPESVEFTLTVLERLAERYGKRKGLLGIQIVNEPNTESSWDTFNIG
ERYKPVDAEMAAGSGPVSFEFLRKFYVEAYDRLRKYLPVEKAVVFHDGFDIYKWKDFMRE
EKFQNVILDTHQYLMMAEMDGCPQTVEGYVSYVKEHYFKMIEEMQQYFPVICGEWCLFNS
LACGVDTKGGQSVLNGMEGKQEEVFSEEEKRKIYRAVADVQLEAWEKGSGYFYWNYKLLV
DTVNESGWIGWDAWDLGRCVAQGWFPTERETKRNM

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	357	3.2e-146	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.65e-28	2	380	17	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.14e-08	30	176	2	141	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY98291.1	6.98e-239	1	392	1	392
QCU02863.1	2.93e-226	1	392	1	392
QRT49144.1	1.03e-225	1	386	1	386
QBE98393.1	1.05e-223	1	390	1	390
AZK47550.1	1.98e-223	1	388	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.07e-187	1	386	1	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.51e-186	1	386	1	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.05e-45	3	386	13	391	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	2.29e-42	3	368	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
2PF0_A	5.03e-42	3	368	15	373	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	1.08e-51	3	392	31	399	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	1.08e-51	3	392	31	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q875R9	2.42e-50	3	386	48	425	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
Q5B5X8	3.13e-50	3	390	29	398	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q0CR35	7.85e-50	3	393	40	410	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_01851.