CAZyme Information: MGYG000000886_02469

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_02469
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000000886_16|CGC1	36161.93	4.835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 16164; End: 17099 Strand: -

Full Sequence      

MNPVNPNATREAKELLNYLYETAGNGIITGQHTQTNPMEEIVYIKEKTGYAPKLQGFELL
GYSPNINYQDVSKECLTEVEENKGTMKTALKWAKETKGIVAMCFHWFSPIGGRDKAFYAE
HTDFDARKVLEEGTAERKAFYSDMDVIAEELKKFQKANIPILFRPFHEADGRWFWWGAKG
DAVGRELYKLMFEYYVNQKHLDNLLWVWNSPAKEGYPGDEYVDVISRDIYLTEKKPTDYK
AEYEELIANTTDKKVAALGEVGYIPDVDMLKESRVPWAFYMTWSKEFCIGEQYNTVEETR
RMYESDYAVKM

Enzyme Prediction     

No EC number prediction in MGYG000000886_02469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	310	3.1e-94	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.52e-50	4	284	1	283	Glycosyl hydrolase family 26.
COG4124	ManB2	5.91e-13	116	268	136	302	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	3.52e-154	1	311	6	334
CBK82137.1	1.43e-148	5	309	6	310
AEB13973.1	1.80e-141	5	311	6	310
AZK45707.1	5.87e-126	1	311	4	314
AOZ93051.1	2.64e-125	3	311	9	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	4.76e-61	3	306	6	302	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	5.32e-60	5	311	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.54e-51	2	311	33	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	6.37e-42	8	283	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	1.20e-40	1	309	21	322	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	6.68e-59	3	306	28	342	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	5.48e-57	5	311	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	3.06e-48	8	287	151	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	1.37e-44	4	311	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	2.74e-42	1	311	153	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_02469.