CAZyme Information: MGYG000000886_02663

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_02663
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773	MGYG000000886_19|CGC1	86334.81	5.099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 36862; End: 39183 Strand: -

Full Sequence      

MQMDCKKLLEEMTLEEKASLCSGLTFWKTKPVKRLGVKEIFMSDGPYGIRKQSEEDSYLD
FHTSKSYICFPTAAGMAASFDRQLWHEMGAALGRECMAERIGVLLGPAVNIKRSPLGGRN
FEYLSEDPYVTGILAAEYVKGMQEQGTSACVKHFAVNNQETRRMSVSANVDERALFEIYL
PAFERIVKEASPDLIMCSYNRINHVFAAENKWLLTELLREKWGFEGVVVTDWGAVCDRVT
GLAAGVDLEMPASGGGSDREIAEAVEKGALEEAVLDAAALRILELSRKHECKQTVRIDYG
KEHKLAQKIAAESMVLLKNQRNLLPLPTKGVTVALIGAFAEQPRYEGGGSSHINSWKVDA
PISAAEDFPAVTFLYAKGYDANGQDKKGQDEVLVEEAVKAAKNADYAVVFAGLPESYESE
SYDRRHLKLPSEQNRLIRLISEAQPDTVVVLQNGSPVTMPWIDRVPAVLEAYLGGEACGK
AIMDTLFGKVNPCGHLAETFPLRIEDTPCYLDFPGRYDETDYREGVFVGYRYYLSKKKQV
LFPFGFGLSYTEFEFRDLEVFAPDFPEAEGKTEFCAAVTVRNAGTRAGKALIQLYVEPDA
AAAPVLRPLRELKGFEKAALLPGEEKRVNITMDKRAFAFYDVTIHDWYTAPGTYKIQIGS
DCETILCEKRIYVEPVQIKKIKIDRNTLIGDLLESSGTKEVMEEVLPSLLETMGVGGVRD
ESGKLQKERIPAFVRELPLRSLISFTDGVFSKEQLAELLERLKKTQMRDDERR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	251	4.8e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.50e-98	70	661	120	753	beta-glucosidase BglX.
COG1472	BglX	8.99e-69	34	351	57	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.73e-68	314	530	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.20e-62	70	633	114	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	8.39e-40	70	285	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ41103.1	6.04e-261	1	762	1	751
ASU30988.1	5.19e-258	1	762	1	752
ANU78179.1	5.19e-258	1	762	1	752
QQQ91519.1	5.19e-258	1	762	1	752
QJU15992.1	5.19e-258	1	762	1	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.22e-254	1	762	1	751	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.71e-178	9	748	9	731	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	6.71e-119	2	674	3	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.16e-114	2	674	3	837	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	5.90e-109	7	665	6	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.51e-253	1	762	1	751	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.36e-172	9	665	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	4.28e-171	9	665	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
B0Y3M6	2.82e-130	2	666	3	823	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
Q4WU49	1.10e-129	2	666	3	823	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_02663.