CAZyme Information: MGYG000000889_00084

Basic Information

• Species: CAG-279 sp900541555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541555
• CAZyme ID: MGYG000000889_00084
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725	MGYG000000889_1|CGC2	83821.92	4.9458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000889	2172459	MAG	Denmark	Europe

• Gene Location: Start: 104260; End: 106437 Strand: +

Full Sequence      

MKRVFAFILSILSLYGSAVYANGEVEAAKSMVVRLLPDYANHFEFRLIPNDNGRDCFSIE
SQGDKIVISGNTAGSMAVGLNAYLTRHCRTSVSWYAENPVAMPDTLPAVPKKEYAFARVE
RRFFLNYCTFGYSMPFWDWTEWERMIDWMALNGINMPLAITGQETVWYNVWRTLGLSDSE
IRDYFTGPVYLPWHRMANIDSWNGPLPMEWLQKQAQLQNQILERERAFGMRPVLPAFSGH
VPSQLQRLYPEADIKYLGKWAGFDDRYRCHFLNPEDSLFAVVQRLYLAEQTRMFGTDHVY
GVDPFNEVDPPSWEPDYLKDISHNIYRTIADFDPEAEWVQMSWMFYHDRKYWTAPRIEAF
LSGVDAGKMTLLDYHCENVELWRKTERFHGQPYIWCYLGNFGGNTSLTGPVKASGARLEA
ALEDGGDNLIGIGSTLEGLDVVQFPYEYIFSKAWSNALPDEKWIENFADCHSGEASLEVR
EAWKILFDDVYVQIPRTLGLLSCFKPIFGRSEDYRTRINYDNSRLAEAWYWLLDAPNTER
EAIRADLVCVGRQAIGNLYGRLKAELDSAYLRKDLPQMRRTADAMRGMLADLDTLTAYHP
RCGVGVWLRDARAYGETKELKDYYERNARNLITTWGGSLNDYAARAWSGLFGSYYAGRWE
IYFDALEKSCEAGTPLDEEQLREQLAAFESAWVASTEPMPVIVPKQDLLSFSVKLYRKYM
ERYWE

Enzyme Prediction     

No EC number prediction in MGYG000000889_00084.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	63	716	4.6e-227	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	122	456	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	9.34e-71	463	712	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.94e-27	26	107	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12614.1	0.0	1	722	1	721
QUT77134.1	0.0	1	719	2	719
BBK85843.1	3.76e-314	24	722	8	704
QMI79386.1	9.85e-314	24	722	25	721
QDH53244.1	6.67e-308	1	719	1	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	6.18e-153	24	723	5	715	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	8.60e-92	20	673	165	831	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	9.93e-92	20	673	173	839	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	9.27e-91	20	673	188	854	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	3.02e-153	24	723	28	738	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.46e-136	27	719	48	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000331	0.998944	0.000178	0.000197	0.000182	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000889_00084.