CAZyme Information: MGYG000000889_00631

Basic Information

• Species: CAG-279 sp900541555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541555
• CAZyme ID: MGYG000000889_00631
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42075.91	9.4364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000889	2172459	MAG	Denmark	Europe

• Gene Location: Start: 46282; End: 47427 Strand: +

Full Sequence      

MKYFLIAGEASGDLHAGRLIDALRREDGEASFCYLGGDCMQAASGVAPVVHYRAMAYMAF
SEVLRHLPDIFKNMRIAKESIARFAPDAIVLVDYPSFNLKIAKYAWRKGIPVYYYISPKI
WAWKTWRVKQIKKYVRKVFSILPFETEFYAKYGYAVDYAGNPTVGEIADARQALPSEEEF
RKLAGVSADVPLIALLPGSRIGEIRNNLPLMADAARRFAGFQAVVAAAPGIETDFYRTVC
PDGIRIVRDATYALLAYSKAAVVTSGTATLETAIMGTPQVVCYRGNGSSMTYALFKRILK
VRYVSLPNLIAGKEVVPELLLHQCTADGMAKLLRPLLGDTAERRAMEEGYALVAQRLGKM
DCAKTTAQQLLNDLTNGAGRH

Enzyme Prediction     

No EC number prediction in MGYG000000889_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	8.9e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.32e-115	1	372	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.56e-108	1	371	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.67e-86	4	364	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.08e-70	5	370	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.23e-53	1	331	2	311	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	1.74e-126	1	376	1	376
BCI64292.1	2.63e-122	1	375	1	375
AHF12800.1	8.33e-120	1	374	1	373
QQR08529.1	3.83e-119	1	376	1	375
ASB37800.1	3.83e-119	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.85e-41	5	371	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.59e-41	5	371	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.97e-73	2	377	6	381	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	4.18e-69	5	371	8	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	4.29e-69	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q02AZ6	1.77e-63	2	381	3	379	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q74AT9	1.92e-63	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000889_00631.