CAZyme Information: MGYG000000892_00048

Basic Information

• Species: CAG-115 sp002492075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp002492075
• CAZyme ID: MGYG000000892_00048
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	MGYG000000892_1|CGC1	33997.51	5.6015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000892	2629881	MAG	Denmark	Europe

• Gene Location: Start: 36783; End: 37682 Strand: +

Full Sequence      

MTRIKGVDISYCQEGINFAELQKAGVRFAIIRAGFSTKKDVTMDKFVADCNKYGIDYGFY
WYSYAMSIDEAKAEAEKCVEVVKGLAPTYPVFFDLEEKRQINGLNNATRTEMAKTFCEIV
RAAGFTPGIYANPSFIECYYNKGELIGKYDIWLAHWTGSPNKPSKYDYGQKMWQWGLDNI
GDLSRAGSYDIDGDICFADYAVKEPVAEKTVDELAQEIIAGKWGSGIERKERLTAAGYDY
YAVQNRVNEILYKPKKSVDELAREVIRGDWGNGEERRKRLIAAGYDYSAVQKRVNEILR

Enzyme Prediction     

No EC number prediction in MGYG000000892_00048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	7	175	2e-35	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.49e-60	4	197	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	9.02e-21	5	174	1	167	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam08230	CW_7	7.86e-20	259	298	1	40	CW_7 repeat. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is also found in the cell wall hydrolases of human and life-stock pathogens. CW_7 repeats make up a cell wall binding motif.
pfam01183	Glyco_hydro_25	4.75e-19	7	175	1	171	Glycosyl hydrolases family 25.
smart01095	Cpl-7	2.94e-18	258	298	1	41	Cpl-7 lysozyme C-terminal domain. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is assumed that these repeats represent cell wall binding motifs although no direct evidence has been obtained so far.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK97096.1	4.02e-66	1	210	1	204
QQO42089.1	1.37e-45	1	251	1	256
QAR21437.1	7.53e-45	1	251	1	256
ADU27377.1	1.10e-44	4	251	3	259
AVQ96437.1	1.10e-44	4	251	3	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVD_A	5.12e-07	214	251	4	41	ChainA, LYSOZYME [Streptococcus phage CP-7]
5I8L_A	5.62e-06	209	251	6	48	ChainA, Lysozyme [Streptococcus phage CP-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19385	1.02e-10	21	250	23	244	Lysozyme OS=Streptococcus phage Cp-7 OX=10748 GN=CPL7 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000892_00048.