CAZyme Information: MGYG000000892_00340

Basic Information

• Species: CAG-115 sp002492075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp002492075
• CAZyme ID: MGYG000000892_00340
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42448.75	4.6815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000892	2629881	MAG	Denmark	Europe

• Gene Location: Start: 9424; End: 10572 Strand: -

Full Sequence      

MRIKQMVSAVLTATMLICVSGCGSKNDSSGGSESTVSTVPSSPDRPGEMNITSAADVVKQ
MRIGWNLGNTLDATGGEGLTAETSWGCPVTTKEMIDTIKGAGFNVLRVPVSWGTHLDEEG
NIDKAWLDRVQEVVNYGIDNDMFVILNTHHEEWYMPTKNHVESDLKTLEKLWQQISERFK
NYGDKLMFEGLNEPRLRGQGAEWTGNKSAREIVNQYEETFVKTVRATGGNNEQRILFISP
YAASSTRENLLAVKIPENAGNVIVSVHAYLPYDFALNTKGTSFYENDGSIDTLMDNIQSI
FLDNGIPVVITEFGCINKGNSEDRLKCIEDYLTAANKKGVPCVWWDNNSRVTTSEGFGLL
NRANNTWYFPEIIDKINKIMGE

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	348	2.1e-95	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.96e-73	71	349	1	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.63e-33	64	378	54	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO06082.1	5.16e-158	1	381	1	383
ADU20585.1	1.24e-144	2	374	5	392
AAA26469.1	5.38e-141	27	374	41	392
CAA38693.1	9.71e-140	1	378	1	398
ADK66823.1	4.33e-118	46	378	25	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	1.82e-107	46	378	8	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6Q1I_A	1.05e-104	50	376	10	349	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6PZ7_A	1.98e-99	53	376	8	333	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6MQ4_A	2.00e-98	45	381	4	350	ChainA, cellulase [Acetivibrio cellulolyticus]
6XSU_A	4.41e-98	53	381	12	354	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16216	1.08e-141	27	374	41	392	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P23661	1.94e-140	1	378	1	398	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P54937	9.49e-103	50	376	35	374	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	1.64e-102	45	376	18	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	3.84e-92	54	381	43	373	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000892_00340.