CAZyme Information: MGYG000000892_00965

Basic Information

• Species: CAG-115 sp002492075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp002492075
• CAZyme ID: MGYG000000892_00965
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		34525.95	5.464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000892	2629881	MAG	Denmark	Europe

• Gene Location: Start: 9810; End: 10727 Strand: -

Full Sequence      

MKEITVTPFDNLAAILGTVEPHTRILLSEGVYKQKVEINVPHIELIGAGGDKTAIVFDDY
AKKLDKQGREYNTFRTYTIAVTAPHVRFRNLMVENSAGDPKNKGQEVALTVYADDFFAEE
CSFVSTQDTIFCGPLPPDLIIRYDGFLKDSLRSEGSSKQIYKNCFISGTVDFIFGCADAL
FENCEIKSLYEVRGHGYAAAPAHALEQEIGFVFSKCRFTRDARTPDGSVFLARPWRDFGK
ASFIDCEYDTHIASDGFNKWNDTNRDKTARFAEYGTDRQGRVLWSREMSVMEKDALLNYF
AERRL

Enzyme Prediction     

No EC number prediction in MGYG000000892_00965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	22	289	1.1e-67	0.8472222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.67e-45	25	289	115	389	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	6.65e-44	8	289	93	348	pectinesterase family protein
PLN02773	PLN02773	6.38e-36	23	297	35	291	pectinesterase
pfam01095	Pectinesterase	1.05e-35	25	285	32	275	Pectinesterase.
PLN02432	PLN02432	1.05e-34	25	297	43	281	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU22686.1	1.22e-124	11	300	11	300
AQR96711.1	7.05e-63	25	285	32	296
AGF58031.1	7.05e-63	25	285	32	296
ADZ82949.1	1.43e-59	9	292	11	302
QEH68466.1	4.46e-58	9	292	11	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	1.55e-24	25	284	63	317	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.90e-18	25	284	37	293	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	2.50e-17	25	284	39	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	8.86e-15	25	284	35	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1QJV_A	1.98e-14	25	284	37	293	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VYZ3	2.61e-29	25	298	116	371	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9SIJ9	2.17e-27	25	298	83	322	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
O23447	3.50e-27	25	284	422	665	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1
Q8GXA1	4.70e-27	25	305	288	551	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	1.67e-26	23	288	35	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000892_00965.