CAZyme Information: MGYG000000892_02006

Basic Information

• Species: CAG-115 sp002492075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp002492075
• CAZyme ID: MGYG000000892_02006
• CAZy Family: GH5
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		38012.6	4.5804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000892	2629881	MAG	Denmark	Europe

• Gene Location: Start: 2730; End: 3791 Strand: -

Full Sequence      

MKLKKISALLMSAVLAVTVCGCSKSQTSSDTGSAPAVGESSAVSDTTSTPDAPAEGGFKV
DGTKLLDAKGNEFVMRGVNHAHVWFRSQLDAALDGIAATGANCVRIVLADGDQWDRIPAD
ELETVIQKCTDRKMIVIAEVHDGTGKNKQSFLDNAVDYWIEVKDVMNAHTDTVILNIANE
WLGNRNVDSWKNGYTSAIPKLREAGIKNTIMVDSAGWGQYGEIVGKAGQEVFDSDPDKNT
MFSVHMYGTAGKNEETITTNIKSATDKNLCMVVGEFGYNHSDGDVDEAFIMKYCVENSIG
YIGWSWKGNGGGVENLDIAKDWSGNTLSADWGEVLVNGENGIKKTAKICSVFE

Enzyme Prediction     

No EC number prediction in MGYG000000892_02006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	67	313	1.2e-93	0.9881422924901185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.09e-36	66	310	1	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34898.1	1.13e-147	56	352	57	353
CBK96294.1	1.66e-147	4	352	3	354
QJU43361.1	2.29e-119	49	352	32	334
QGH23260.1	2.29e-119	49	352	32	334
QCJ05579.1	2.29e-119	49	352	32	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUG_A	3.74e-110	54	352	21	318	Crystalstructure of endo-beta-1,4-mannanase from the alkaliphilic Bacillus sp. N16-5 [Bacillus sp. N16-5]
1WKY_A	1.43e-109	52	352	4	303	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
2WHJ_A	5.05e-109	57	352	2	296	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
2WHL_A	4.77e-106	57	352	1	293	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
1BQC_A	7.50e-78	57	352	3	301	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1K3N4	2.76e-108	57	352	2	296	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1
P51529	6.53e-76	54	352	36	335	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
B3PF24	5.35e-74	54	352	45	345	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P22533	1.17e-61	55	333	43	314	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000892_02006.