CAZyme Information: MGYG000000894_00552

Basic Information

• Species: UMGS1307 sp900550505
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1307; UMGS1307 sp900550505
• CAZyme ID: MGYG000000894_00552
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		78204.98	4.6813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000894	1390532	MAG	Denmark	Europe

• Gene Location: Start: 3086; End: 5212 Strand: -

Full Sequence      

MDFIRKSADFSTLERHVNAPLIRRSFTVPGECDAEIVVASTGFYVLYLNGRDITKGQLAP
YISAPDDIVCCDRYSVRLDAGENVVALMLGNGMQNSVCGFVWDFDKAAWRGAPSVAFTVK
GPGVCIDSGEGCRCSDSPVTFDDLRGGEDFDARLMISGWNEKGFDDSGWSEAEKAPEPRG
RLKPCTAEPIVTERELTPVTVTCGHDGTLFDFGVNTSGVPRLRVRGERGTTVTLTCGELL
RDGCLTQDNIKCDRDQRCQVIKYTLTGDDGTEEYIPFFTYCGCRYVLASSDRPLDVLDIS
FLVRHSGLKRRGSFRCSDETVNRLQEMTERSTLSNFWYFPTDCPHREKNGWTGDAAISAE
QTLLNFDAVRSYREWLAHIREAQRADGALPGIVPTGGWGFKWGCGPAWDCVIVFLPYYSY
LYDRDISVLEENADAVSKYLSYMHTRLNPDGTASYGLGDWCSPGRPSGDPKTPLAVTDTL
VCADMCRKAAYIFSVLGQSGRCTAANELAKELLVSFRRAFLDDTGTRVRCMTQTAQALAL
SCGVFEDGDDYRAAYEALKLMIEENGGLHDCGIIGCRVIFRLLADNGDCDLALKMITDRR
SPGFGSWIEAGATSLWESFPSSPAEILSMNHHFFGDISAFFYRCIAGIRMEEDGVTVSPC
FPDSVDEAEAWHDTPHGRISVHWRREPDGSISIDSSLPDVLKKSDGCS

Enzyme Prediction     

No EC number prediction in MGYG000000894_00552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	206	698	1.6e-117	0.9682539682539683
CBM67	15	177	2.3e-22	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.51e-82	309	645	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.69e-26	33	193	5	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.96e-15	208	305	8	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.62e-08	647	698	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	5.91e-128	19	708	50	746
QGQ94103.1	2.29e-127	14	686	138	820
AVM44977.1	3.21e-120	19	702	17	698
AYB33152.1	1.80e-117	9	698	161	867
ATL47751.1	8.47e-117	19	702	150	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.12e-81	19	698	176	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.32e-60	22	700	305	988	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.57e-57	23	683	135	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	8.49e-07	74	702	290	936	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	8.38e-66	22	683	177	855	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	1.16e-63	19	698	184	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.73e-59	22	700	305	988	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.46e-55	22	698	173	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000894_00552.