CAZyme Information: MGYG000000900_00024

Basic Information

• Species: UMGS902 sp900546635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS902; UMGS902 sp900546635
• CAZyme ID: MGYG000000900_00024
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1443		155128.47	5.2482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000900	2178918	MAG	Denmark	Europe

• Gene Location: Start: 23419; End: 27750 Strand: -

Full Sequence      

MNPAFERFAKRILCLCMLTLCALLTFFAFQMNASAASAEEIVVYVDSKAGNDEAAGTTPE
TPLKTLPVAIDRLKDSGGRIVVMNAYTFSSGMTEPRHTGSITITSSDGVTDYGKNGAKLL
FGNTLRYILNGNTGFENIRIEFGNTLNFVANYNRITFGTGVTTQNTGAGDGVYIVGGYQN
PSNDADITKDSHITIQSGTFFTVIGGSRHIAPGAENMAFTGTHYIDISGGLISKVYGASM
QRQYSNHAKITVSGGRINQLFTGGDVSRRLNGNALLTLSGGTINQLHINNVIGKADVYLT
GATVKKATVSYNNAEVTELARKSNKPKTLYYNALFYEPSQIGLVTPDFDATVNITKVYAK
DGAAGTGASLSDPASFADAFTKAAKMGGEIAVVGTVQLHNFSEPEHSADVQITGTDQNGA
LIVGGVYTLNGKTTFDNIALTANSCVFDAQNGNLIIQDTVKMSGKADVTGSAALYTGIFG
TISGGNANASITLDGAIANTIVGGTKSAEIEIISGIINTVKTADSKIKRFFLNISGGNIQ
KLELNNVTEQLDLILYGGKIDTYILGGKCVPGTLKLNQSLYRLSDLGDAASLFSIREENA
VYLANGGTGNGITPSQPLGSLKDAYTALPNGGVIVVCGDYTVSEAFINVTNPSKITITSV
YDGIDYAKSNKAKLHFQANFYCGGETEFHDITLVCEKNYSALYGNGYKLTLGDRITCEKA
VNINTYLSVMGGGASSISRPETDLTISSGKWQRVRGGNATNGSKTLDVRLTVNGGEFFER
LTLGGALSHNGDIHAEINGGTFYQGIFASTLDSNNLSLNSNITLTINGGTVYGTIAAAST
KLGTYAGSYTVRINGGEFAHVTDFLGTEALNGGMTSTLYHAPYIDIRQNETGTMSFTNPI
RQNGADPWLFFHEGNYYYIATTGSQLKLYKAANIGDLKYDPGKLIYKPAEGTMWSKSLWS
PEIHYFGPEDFSEEYAGWYCFIACDDGDNVNHRMYVIKCLTDDLMGPWGHPLTKEANVPI
KVESPDNPKLTNETWAAGQTGIRINGQFYTMWVGETGRNTPDFHQTINIAKLSNPWTITD
SYGVICVPEYSWEMGGYSYDASTGTGYPKVVEGGTAVYGSDGSIYIVYSGSGYWTTEYKL
GQLKYLGGDPLDIKNWEKLPTPILSKSESINGCGHASYVTDTDGQGWICYHAYIGTDTSS
GRYAFVEPYTADKNGVVIGSGSKKPADIDTVYTVNLNPRPLAEKIDGFHSTLQTSEKFPP
IRTYQNQFTDISVSHWFYTFIKSAYEIGLANGTGERAFSPDSNFTVAQALTAAANIHSIY
YQKEINAVGAANWYAPYVEYCLENNIITAGQFSNYDANISRGDMAIVFAGILPETEYTAL
RSGTNPDVSSDMACYGAVQKLYNAGIVGGDTDTGNYRPNDEIRRSEACVLFTRIALPDTR
AVN

Enzyme Prediction     

No EC number prediction in MGYG000000900_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	896	1216	4.6e-72	0.9931972789115646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08980	GH43_LbAraf43-like	7.41e-72	905	1193	1	276	Glycosyl hydrolase family 43 proteins such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities. In addition to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) familiesGH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18820	GH43_LbAraf43-like	1.27e-70	905	1192	1	257	Glycosyl hydrolase family 43 proteins similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities, similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18817	GH43f_LbAraf43-like	6.67e-37	905	1192	1	261	Glycosyl hydrolase family 43 such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43. This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with alpha-L-arabinofuranosidase (EC 3.2.1.55) activity. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. Characterized enzymes belonging to this subgroup include Lactobacillus brevis (LbAraf43) and Weissella sp (WAraf43) which show activity with similar catalytic efficiency on 1,5-alpha-L-arabinooligosaccharides with a degree of polymerization (DP) of 2-3; size is limited by an extended loop at the entrance to the active site. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18818	GH43_GbtXyl43B-like	2.24e-34	905	1192	1	272	Glycosyl hydrolase family 43 such as Geobacillus thermoleovorans IT-08 beta-xylosidase/exo-xylanase (GbtXyl43B). This glycosyl hydrolase family 43 (GH43) subgroup includes the characterized enzymes Geobacillus thermoleovorans IT-08 beta-xylosidase (EC 3.2.1.37) / exo-xylanase (GbtXyl43B), and Paenibacillus sp. strain E18 alpha-L-arabinofuranosidase (EC 3.2.1.55) Abf43B. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG3940	COG3940	9.63e-32	898	1215	7	306	Beta-xylosidase, GH43 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR70064.1	1.09e-207	40	1248	33	1273
QOR70069.1	3.26e-206	6	1248	4	1275
QMU96449.1	3.35e-199	43	1250	37	1277
ACQ82437.1	7.05e-198	22	1248	13	1273
SDS43825.1	3.25e-197	27	1248	19	1273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M8E_A	2.39e-21	893	1215	22	331	Crystalstructure of a GH43 arabonofuranosidase from Weissella sp. strain 142 [Weissella cibaria],5M8E_B Crystal structure of a GH43 arabonofuranosidase from Weissella sp. strain 142 [Weissella cibaria]
3AKF_A	4.42e-21	893	1191	8	278	Crystalstructure of exo-1,5-alpha-L-arabinofuranosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3AKG_A Crystal structure of exo-1,5-alpha-L-arabinofuranosidase complexed with alpha-1,5-L-arabinofuranobiose [Streptomyces avermitilis MA-4680 = NBRC 14893],3AKH_A Crystal structure of exo-1,5-alpha-L-arabinofuranosidase complexed with alpha-1,5-L-arabinofuranotriose [Streptomyces avermitilis MA-4680 = NBRC 14893],3AKI_A Crystal structure of exo-1,5-alpha-L-arabinofuranosidase complexed with alpha-L-arabinofuranosyl azido [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82P90	2.70e-20	893	1191	34	304	Extracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=Araf43A PE=1 SV=1
G4MMH2	9.92e-11	894	1192	39	311	Alpha-L-arabinofuranosidase B OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=abfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.044989	0.952413	0.001461	0.000494	0.000317	0.000303

TMHMM  Annotations     

start	end
12	29