CAZyme Information: MGYG000000900_00450

Basic Information

• Species: UMGS902 sp900546635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS902; UMGS902 sp900546635
• CAZyme ID: MGYG000000900_00450
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799		85136.23	5.2492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000900	2178918	MAG	Denmark	Europe

• Gene Location: Start: 29855; End: 32254 Strand: +

Full Sequence      

MKKSFALFFTATVLPLFGLFTVSAAAYTFTPGSEAVVYVDGAAGSNSNTGASASAAVQTL
DQAYALLRKSGGGTLVVSGAVSVPGSSFAPASTDGAVLYTSVYGGVDYRTQGAALKVAAH
MAFNNDTYFDDIRLEIEKSNLILSGRYHNFGIGAGVDCVSTASAPINFPLLVGGYNDPAT
IAMASTDKSYTLTVAGGAWQGLMGGNRRGSSTKAIGVLSGDIAVLIEGGVFDKGSGSQYV
SASGACFHMGRLYMEITGGTFNEDIYIYRRLGTLPSDASLKADSASKAQTVVRLLGGNFN
GSLFTANETPGAAEIWSDVCIVVTDAAFSSASRLYNRGVLGSVVIRCSAETEAALLAHCD
GAFLFSNSLDSAAGATTTAHFSGWVNSLQDPYVVEKDGVFYYCFSSGASVNGVTYPGIKI
AASTEILFSNMSYNSVSVFNAAKTDIPNAKKEYWAPEMHYFSAEEVGAADAGWYIYFAAD
DGENANHRMYVLRASDPEDPTSTYSMVGQLVTDEDKWAIDGTVLKYGGKLYFVWSGWPGD
VNGCQNLYIQEMENPYTMKTGKRVLISTPTYDWETKDRPLVNEGPQALVLDGTTHIVYSA
SGSWGKNYCLGVLTLTGDDPLVASNWYKHPKTVFSSDAGASRYGTGHSSYVQNYHDGSFW
MYFHANPSLTVSAGSSWWADREVYAQPFTVKEVRINGKTYSFPDFGTPLAPSAARGVTVT
SPDFCAGGHWYGGAGGVCRICGAKAPLTGRYKDVNGDGCTNTLDALIVMRWMRTGERPAS
LDDVLWILRYAAGTLHIDR

Enzyme Prediction     

No EC number prediction in MGYG000000900_00450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	386	692	1.3e-81	0.9625850340136054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18820	GH43_LbAraf43-like	7.35e-109	389	666	1	258	Glycosyl hydrolase family 43 proteins similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities, similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08980	GH43_LbAraf43-like	4.15e-65	390	666	2	276	Glycosyl hydrolase family 43 proteins such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities. In addition to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) familiesGH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18817	GH43f_LbAraf43-like	8.19e-51	454	665	58	261	Glycosyl hydrolase family 43 such as Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43. This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with alpha-L-arabinofuranosidase (EC 3.2.1.55) activity. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. Characterized enzymes belonging to this subgroup include Lactobacillus brevis (LbAraf43) and Weissella sp (WAraf43) which show activity with similar catalytic efficiency on 1,5-alpha-L-arabinooligosaccharides with a degree of polymerization (DP) of 2-3; size is limited by an extended loop at the entrance to the active site. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG3940	COG3940	7.73e-50	454	712	71	317	Beta-xylosidase, GH43 family [Carbohydrate transport and metabolism].
pfam04616	Glyco_hydro_43	2.57e-39	390	692	12	277	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR81278.1	4.61e-68	389	722	34	328
AGB19348.1	5.28e-68	390	710	45	334
QGQ98669.1	9.12e-66	390	709	46	330
QHW31890.1	2.10e-65	359	713	12	334
QRR01273.1	6.60e-65	390	709	39	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M8E_A	6.77e-39	390	708	35	338	Crystalstructure of a GH43 arabonofuranosidase from Weissella sp. strain 142 [Weissella cibaria],5M8E_B Crystal structure of a GH43 arabonofuranosidase from Weissella sp. strain 142 [Weissella cibaria]
5M8B_A	2.79e-35	390	709	37	341	ChainA, Alpha-L-arabinofuranosidase II [Levilactobacillus brevis],5M8B_B Chain B, Alpha-L-arabinofuranosidase II [Levilactobacillus brevis]
3K1U_A	1.62e-32	454	712	75	321	Beta-xylosidase,family 43 glycosyl hydrolase from Clostridium acetobutylicum [Clostridium acetobutylicum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.999027	0.000154	0.000180	0.000155	0.000144

TMHMM  Annotations     

start	end
5	27