CAZyme Information: MGYG000000901_01625

Basic Information

• Species: Acidaminococcus fermentans
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus fermentans
• CAZyme ID: MGYG000000901_01625
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000000901_32|CGC1	40477.03	6.3674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000901	2058329	MAG	Denmark	Europe

• Gene Location: Start: 20325; End: 21410 Strand: -

Full Sequence      

MKKRWIAIFGLCLMTFTGTACARPAQKESAEPVQNPLVREPCRPQKTEGPVGLVWDWQAP
GEKTSTLAKEKKLPGINVLSPSWFVIRDTEGNIEVKNASPDYAPQAHASGYKVWALITNG
FDPERTHGLLDNPAGRRNAVEGILALAKQYQLDGINLDFENIQAADSDRLTDFVGEIAGP
LQQGGYTVSIDVTVPSDNGNWSRCYDRKALAEKVDYVMLMAYDEHSPLSPKAGSVASLPW
VEQGIRNTLKEVPAEKLVLGMPLYMRDWKEENGKVSARTLSMEGARKLIAEKGLVPAWHS
EEAQYYFEYREQGVLHRVWQEEARSLALKNALISRYNLAGSAYWRKGLEEPEVWAAMEKW
R

Enzyme Prediction     

No EC number prediction in MGYG000000901_01625.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	93	347	2e-39	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.76e-91	74	357	24	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.04e-61	46	358	99	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	3.25e-33	72	354	20	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	6.82e-31	84	344	33	329	Glyco_18 domain.
cd02875	GH18_chitobiase	3.10e-28	130	344	91	334	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB47041.1	8.53e-269	1	361	1	361
QIB60827.1	2.83e-98	45	359	32	344
QJW48079.1	4.34e-98	41	359	157	476
BDA10778.1	9.15e-97	45	359	32	344
BBB92123.1	2.66e-94	49	358	164	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	2.69e-34	116	350	76	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	8.66e-26	134	357	87	310	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	6.69e-24	113	358	173	424	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.90e-22	117	354	176	418	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4Q6T_A	5.21e-19	121	358	83	336	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	9.12e-33	116	345	168	399	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	9.05e-31	112	359	86	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O31682	2.30e-24	52	287	10	231	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P37531	3.51e-23	116	354	169	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	3.57e-21	103	354	161	417	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000458	0.342052	0.656938	0.000250	0.000157	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000901_01625.