CAZyme Information: MGYG000000901_01653

Basic Information

• Species: Acidaminococcus fermentans
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus fermentans
• CAZyme ID: MGYG000000901_01653
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		45490.78	10.0269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000901	2058329	MAG	Denmark	Europe

• Gene Location: Start: 1542; End: 2735 Strand: +

Full Sequence      

MEYWENDGSPLLRFYHRHWPALLLLLLSLVLFFAGNSRMLITDPVESNYALTAREMLAAG
DWLSPRIYGNFWYDKPWLFYGELLISFRLFGVTSFAARFFPAVFATIGVLQTYWFAQKLY
NRKVGFLSGLIMATSVEYFYLAKAVITDMTLFVTTTGSLMLFYVAKSENKSRLLYGAYSL
TGLALLTKGPVGLVLPGLIILAYLAGNRDFRTLTRMKLIRGSLLTLGIAALWYGPMIALH
GTDFLTGFIGVHNILRATVSEHPRNNTWWYYFLIFLIGCFPWSLSLPWLWKKYGHILKER
IKTRTFWKNLNDRQRFLFLWAFVTWFFFECMATKYPTYTLPYLPPLAIGLACAGRLPAGM
RPGWLPPAMRRGCRCMYMAAGIPCPSPTTAESPPPGW

Enzyme Prediction     

No EC number prediction in MGYG000000901_01653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	17	356	1.1e-91	0.5981481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.36e-42	32	353	21	335	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	7.11e-29	44	351	31	330	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.58e-13	74	230	1	155	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.29e-04	46	202	32	196	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG5305	COG5305	1.75e-04	73	260	95	283	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB46573.1	2.78e-258	1	353	1	353
AXL22207.1	3.23e-122	23	351	35	372
AVO74995.1	2.78e-121	20	351	27	361
CCC74317.1	2.78e-121	20	351	27	361
AVO27725.1	7.88e-121	20	351	27	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.79e-23	21	348	34	358	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	1.21e-27	43	353	27	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	2.23e-27	43	351	27	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B4ETL9	6.59e-26	22	354	13	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
C5BDQ8	4.04e-25	40	351	26	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A8GDR9	4.56e-24	19	351	8	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
95	117
124	146
183	205
218	240
268	290
316	338