CAZyme Information: MGYG000000902_00299

Basic Information

• Species: Clostridium neonatale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium neonatale
• CAZyme ID: MGYG000000902_00299
• CAZy Family: CE17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	MGYG000000902_2|CGC3	64349.48	4.6357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000902	4770522	MAG	China	Asia

• Gene Location: Start: 98017; End: 99732 Strand: -

Full Sequence      

MSNNKQSGPKAPKDPQKRRSGFYIMVDKILEATARCEGKPSQEFYLDEGRLSFDAQFVGG
VEDENILNLLKNFDGFYKVVHSIGISVVASDEAGTINFVFQNYGETDKYGGGTQIKLPCE
KDGSEMIFNIDEYEWLKDEYVVGKMAFEFEKPGLTAKATVKIYLNDGYETPEISIDSPVE
FESDDYNSMISRSLLSLGNNKRLKAAIDKAKNGRDINIAYIGGSITQGAGAKPIHTNCYA
YKSYLKFKEMFERDGADNVHFIKAGVGGTPSELGIVRYNRDVLRNGNVKPDIVVVEFAVN
DEGDETKGKCYESLILNILSDENKPAVILLFSVFANDWNLQERLSPVGKHYNLPMVSISD
AVVDQFKLTKEEGNVISKRQYFYDIYHPTNDGHTIMADCLAYLFEQTEKNSCDIIDISLD
KEPVIGDEFIGMHLIDRRDNECKAVIEHGSFKQIDTDLQFVEMDDNQDGTAQFPYNWMHA
PGFGDESFLLTVNSRSLLLVFKDSGRLDFGKADIFVDGIFAMTIDPQEAGWTHCNTVILY
NEKNIREHKIEIKMAHGDKDKYFTILGFGYN

Enzyme Prediction     

No EC number prediction in MGYG000000902_00299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	220	393	4.1e-40	0.9878787878787879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00229	SGNH_hydrolase	1.11e-15	218	401	1	185	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	3.55e-13	221	395	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01834	SGNH_hydrolase_like_2	5.01e-13	215	397	1	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd04501	SGNH_hydrolase_like_4	2.62e-04	216	398	1	177	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01827	sialate_O-acetylesterase_like1	3.81e-04	216	397	1	180	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF46877.1	2.12e-263	7	570	14	577
QYK61360.1	7.14e-238	4	570	12	578
EEV02614.1	3.63e-35	202	555	19	351
CBL10432.1	2.43e-34	202	555	19	351
CBL12377.1	2.43e-34	202	555	19	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HH9_A	1.49e-36	202	555	19	351	Crystalstructure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82]
6HFZ_A	2.81e-36	202	555	19	351	Crystalstructure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000902_00299.