CAZyme Information: MGYG000000902_01798

Basic Information

• Species: Clostridium neonatale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium neonatale
• CAZyme ID: MGYG000000902_01798
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		31928.96	8.2456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000902	4770522	MAG	China	Asia

• Gene Location: Start: 63072; End: 63902 Strand: +

Full Sequence      

MSKVWKWCLEEDGKLLKGWQQVENNWYYLYPNGTMAIGWAQVESRWFYLNKDGVMQKGWL
QDKGEWYYLEEKSNGHQGEMYVDGAYIIDGKSYKFNSNGVWIKDSLVTKEQLNAVGWKNV
SDFVVKDLNNCLQKFNINTPERIRHFISQCSHESACGIYTKELASRQAYEGRRDLGNAQT
GDGKKYKGAGYLQLTGRSNYQALANYLPDQFVMKGVDYVADNYPWTSAGFWWYKNNMNTL
CDKGADCITITKKVNGGTNGLADRQRYYDLCCNIFK

Enzyme Prediction     

No EC number prediction in MGYG000000902_01798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	138	273	8.6e-21	0.70995670995671

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033840	PspC_relate_1	1.22e-25	9	103	542	648	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
COG3179	COG3179	3.16e-24	104	264	1	193	Predicted chitinase [General function prediction only].
NF033840	PspC_relate_1	2.43e-23	12	99	525	606	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033930	pneumo_PspA	1.98e-20	9	99	475	559	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.37e-20	9	122	515	631	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AET57870.1	3.66e-75	107	275	166	334
AJH00412.1	7.83e-74	104	276	133	305
QMV40485.1	9.53e-74	103	276	152	327
ALB45455.1	2.22e-73	104	276	133	305
QES74436.1	2.22e-73	104	276	133	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	8.70e-09	139	268	92	215	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64203	1.18e-16	140	274	215	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
P44187	2.31e-07	162	268	90	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000902_01798.