CAZyme Information: MGYG000000902_03488

Basic Information

• Species: Clostridium neonatale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium neonatale
• CAZyme ID: MGYG000000902_03488
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669		72798.38	5.9958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000902	4770522	MAG	China	Asia

• Gene Location: Start: 70; End: 2079 Strand: -

Full Sequence      

MKTNKTVTALFLAFAMVLALIPMNKVDAATLTDIKIISETNVTVKQAEKWAKSKNASEEF
IELAQIYFDYAEEHGGVNPAVAYVQSAKETGYGNFGGVLDSTYHNPCGLKTSSGGDDYNP
DAHQRFDTWEQGVKAHLDHLALYAGAKGYPRSDTEDPRHFATIKGKATTVNSLGGNWAPS
TTYGEEVNKLYRDLLSYSGATLTEDEEIKDNSSNSDKNDNSSNNGSETTNNPPNFNVVIP
EAVQATEPVAKPVNEPSNISSTIGWKKENGTWYYYRSNGSKATGWIKPGNDWYYLYSSGA
MASGWSNIGGTWYYLKPSGEMQIGWLKDGSTWYYLEGNGAMSTGMKLINGKKYFLDTSGA
MRTSWFKISGNWYYFSGNGDMVTGWIRPDGNWYYIHDNGTMATGWAKVKDQWYYLNSNGA
MATGWIVYNSDYYYLTSSGALAVNTVIDGWKIGSDGKRGDKVSSGGPSSSKVIVVDPGHN
FGGDDGAYATHNGITYAERDLNMETSLKLKTKLEEKGYTVLLTRNPSDRETLGVTQSLTN
RVNLANNFGADFFVSIHHNSAGAASANGVEVYYSSNGQDASFGGATSSSKVSTSRTLATS
IVNSISNQTGAYNRGAKDNNFFVCRNTKMPSVLVEVGFITNPTEAANCANPIYQDKVATA
IANAIASNI

Enzyme Prediction     

No EC number prediction in MGYG000000902_03488.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	69	192	6.7e-16	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.42e-83	245	456	427	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	6.47e-78	240	457	447	681	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
cd02696	MurNAc-LAA	2.20e-67	472	666	1	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	1.74e-60	473	665	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
COG0860	AmiC	2.58e-59	461	667	33	226	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDH92108.1	6.44e-189	1	667	1	663
ACD24635.1	6.44e-189	1	667	1	663
AIY80730.1	4.71e-186	1	667	1	663
AJF30757.1	5.10e-185	1	667	1	683
AJF33820.1	5.10e-185	1	667	1	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RN7_A	3.81e-19	468	667	1	180	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
1JWQ_A	1.05e-18	471	665	2	172	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
5EMI_A	5.89e-15	468	665	2	174	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
7RAG_B	2.63e-13	467	661	13	201	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]
3NE8_A	1.35e-07	468	665	2	220	Thecrystal structure of a domain from N-acetylmuramoyl-l-alanine amidase of Bartonella henselae str. Houston-1 [Bartonella henselae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54525	1.26e-20	467	667	26	202	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3
Q02114	3.75e-20	467	661	316	487	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q4L6X7	1.31e-19	467	665	116	285	Probable cell wall amidase LytH OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=lytH PE=3 SV=2
Q5HFD1	7.18e-17	447	665	97	285	Probable cell wall amidase LytH OS=Staphylococcus aureus (strain COL) OX=93062 GN=lytH PE=3 SV=1
Q2YT98	7.18e-17	447	665	97	285	Probable cell wall amidase LytH OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=lytH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999119	0.000159	0.000175	0.000153	0.000144

TMHMM  Annotations     

start	end
7	24