CAZyme Information: MGYG000000902_03489

Basic Information

• Species: Clostridium neonatale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium neonatale
• CAZyme ID: MGYG000000902_03489
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772		84316.93	5.0493

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000902	4770522	MAG	China	Asia

• Gene Location: Start: 2592; End: 4910 Strand: -

Full Sequence      

MKIQKKLITFVVMFTMLLSMVPTLNAKAANISDISIISDTDVTEKQAAKWAKSKGATDTF
IDLAELYFEYAEDCGGVNPAIAYVQAAKETGYGKFGGVIDESYHNPCGLKTSSGGGDYDA
SAHQKFNTWDEGVQAHLDHLALYAGAKGYPKSDTYDPRHFATIKGNAKTVNSLSGNWAPS
STYGEEVNKLYRDLLKYSGVSIGDEEIEDDFDDDSDNSSNQSSSTPYPAKPESIPSGLNA
TEVIQLKKVEETQDTSPNEESTIGWKKENGVWFYYKSDETKATGWLKENNNWYMMKNDGV
MLTGWLNDYGKWYYFDEAGPMVKGWKKIDNKWYYFKQSGEMATGTLYDGNNLYYFDGSGA
MSEGSGWKEIGGKWYYFGNGGALKTGWLKDKNMWYYLQGDGTMVTGYKIINSKTYAFDNG
GKMLTGWISVNNVWYYLNSGGDMATGWINVGGKKYYLYDTGAMSKGWINLNGSWYYMSNS
GAMTTGWVESNGDEYYLDTTTGKLVTNTTIDGFKLGSDGKKVKSSSNDGKTDATPGTGSD
SSSNNSSSNNNNSNSGNTNNNNSTIIHDKPTAGKKVIVVDAGHNYGGDDGAYATHNGINY
SERDLNMQTALKLQSELQSRGYTVIMTREESDRSTTAELQSLINRVNIANNINADLFVSI
HHNTAGATAKGVEVYYSSSAQDDTFGGGYSAERLAKSKDLAAAVSSNIASAVGTPNRGAK
DSAFKVVRNTKMPSILIETGFISNPEEAARCADSNSQTKVAKAIADAISARY

Enzyme Prediction     

No EC number prediction in MGYG000000902_03489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	69	192	6.8e-16	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	2.12e-65	257	522	437	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
cd02696	MurNAc-LAA	6.51e-63	576	768	1	171	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	4.82e-56	577	768	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
NF033838	PspC_subgroup_1	9.01e-55	226	522	433	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG0860	AmiC	1.43e-54	573	772	41	227	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APF24287.1	3.56e-164	3	772	7	765
BBK78145.1	7.87e-163	3	772	7	765
QSX04622.1	2.42e-159	16	772	1	746
QCJ08124.1	2.42e-159	16	772	1	746
QGH28125.1	2.42e-159	16	772	1	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JWQ_A	7.65e-22	575	768	2	172	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
4RN7_A	9.78e-18	577	768	6	178	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
5EMI_A	4.40e-16	572	768	2	174	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
7RAG_B	9.35e-14	575	764	17	201	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]
5J72_A	1.65e-13	567	747	437	612	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54525	4.42e-19	575	772	30	204	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3
Q02114	6.07e-17	570	772	316	495	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q9RMZ0	2.24e-12	575	764	333	512	Uncharacterized cell wall amidase pXO2-42/BXB0045/GBAA_pXO2_0045 OS=Bacillus anthracis OX=1392 GN=pXO2-42 PE=3 SV=2
Q2FXU3	9.47e-12	575	768	120	285	Probable cell wall amidase LytH OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=lytH PE=3 SV=1
Q2YT98	9.47e-12	575	768	120	285	Probable cell wall amidase LytH OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=lytH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.998953	0.000189	0.000204	0.000171	0.000159

TMHMM  Annotations     

start	end
7	26