CAZyme Information: MGYG000000902_04136

Basic Information

• Species: Clostridium neonatale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium neonatale
• CAZyme ID: MGYG000000902_04136
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000000902_112|CGC1	50127.78	9.3509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000902	4770522	MAG	China	Asia

• Gene Location: Start: 3096; End: 4385 Strand: -

Full Sequence      

MKLLFIACYSPLINNSAAIETLQYLNKLSDIDGNEIHLLTVNFPQNSVYYDETLLSMMNK
KIRLHAVKGGAIFNKLMPKKSADSHNFSNNKSSGNIKKILRKIKNAVVIPDMYYGWAKNA
SKYGIKLIEDEKIDVIFSMHEPPSSHLCAYYIKKQYKDIPWITYWSDPWLKDSTREKSFI
LKKLIEKNMEKNIISCADKFIFVTEDNRSEYLKDYKKLNKDNTFILNRGFDSKLYDDLSK
EEPPRFIDKNKINIIYTGEIFSKLRDIRPFIEAIENIKKDDYSKYRKLNILFFGNIDDVE
GRKKLEKLDVAKVSPRIPFNEALKYMLNGDILLLFGNKNSKQIPAKIYDYFGANGRIFVI
YGDKNDPIGRITKDNDKCICSYNSSEDIKNNIYNMIEMYEHNNLCSGPDYNYEWNSIVGR
LNKILWGRD

Enzyme Prediction     

No EC number prediction in MGYG000000902_04136.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	4.60e-21	2	397	1	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	7.28e-07	127	334	77	273	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.88e-05	122	334	73	282	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13439	Glyco_transf_4	2.35e-05	125	231	65	167	Glycosyltransferase Family 4.
cd03811	GT4_GT28_WabH-like	3.28e-05	126	308	77	237	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF54848.1	2.03e-230	1	429	1	429
AQR93770.1	2.03e-230	1	429	1	429
AQR89517.1	1.97e-227	1	429	1	435
AQS09150.1	1.97e-227	1	429	1	435
AGX42236.1	1.97e-227	1	429	1	435

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999522	0.000511	0.000010	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000902_04136.