CAZyme Information: MGYG000000906_00250

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_00250
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797	MGYG000000906_1|CGC1	90067.67	6.2497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 313861; End: 316254 Strand: -

Full Sequence      

MMKLNLIAGCVGLMMLNGIVQDIQAQDRLYKNTFPLGDVELLDGPFKHAQELNLKVLMEY
DVDRLLAPFLKEAGLPVKAEPFPNWAGLDGHVGGHYLSAMAMNYAATGNEECKKRMEYML
SELKRCQDSNGGGYIGGVPNGKALWTDIKNGKVESIWKYWAPWYNVHKIFAGLRDAWMYT
GNQEALDMFLKLCDWGISVTEGLSDDQMEQMLGNEFGGMDEIFADAYQITGNKKYLTTAK
RFSHRWLFDSMAAHKDNLDNIHANTQIPKVIGYQRIAEVCGDNQYLDAAGFFWNIVACKR
SLALGGNSRREYFSAMDDFRSHVEVREGPESCNTYNMLKLTEGLFRMTGNAAYADFYERA
LYNHILSTQHPEHGGYVYFTSARPAHYRVYSKPNSAMWCCVGTGMENHGKYGEFIYTHAS
DSLFVNLFIPSRLNWEQEKVTITQETQFPDAETSQFTIGLKGGKSRHFKLLVRRPAWVTE
GYEVKCNGKVVEASEKTDGSSYICIDRKWKDGDKVEVSLPMKMRLETLQGENDFVAIMRG
PILMGASVGTDNLDGLIADDGRWGHIASGKLVPLSETPVLIGSKEEVTDYLNGLKPIEGQ
TLRYKLSGIFNDSKFDGLVLEPFSRIHDCRYMMYWLCMTADGYAAYTKRTQEEEKRLMAL
DARTVDAVSVGEQQPEVDHKMVKENSETGLLKGKKWRDARNGGYFKYTLSTNGKQPLSLM
ATYWGNEQGNRKFEIVVDGTVVATENIVGKWNKEEFVDVEYKLPEALVKGKSQIEVMFKC
EKNSVAGGIFMLRLLTE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	38	544	3.6e-205	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.05e-180	38	543	1	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	7.19e-112	39	551	12	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	6.30e-40	549	635	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	15	795	12	785
ADY37333.1	0.0	18	797	13	797
SCV06553.1	0.0	25	797	23	798
QRQ58640.1	0.0	25	797	23	798
ALJ47143.1	0.0	25	797	23	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.58e-229	24	795	18	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.98e-221	24	795	18	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.45e-26	141	543	128	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	5.75e-17	180	543	158	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.97e-16	180	543	158	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999119	0.000195	0.000158	0.000145	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000906_00250.