CAZyme Information: MGYG000000906_00395

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_00395
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000000906_2|CGC1	33500.12	6.2998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 15627; End: 16493 Strand: +

Full Sequence      

MSRRFILSWCVFFASFLSVLGQSVIKESQKFYSNLLNKDVSYSIYLPDGYGLSERTYPVL
YLLHGWTDDETSWIQMGDMQAITDRTIMQGLAAKMIVVMPNAWDTWYVNSYDGKFPYEDM
FFEELIPYIQRTYKARTEKQFRAIAGLSMGGYGAFLYTLHHPEYFTACAPLSAAIYTEEQ
MKKALDSDRGKLFDKLYGEGNLTSYWYENSVLHLLSKMKEGTSLNVLYYIDCGDDDTLLH
GNNVAHELLQEKNIAHEFRVRDGGHTWTYWRTALPSVLEFVTKRFRRS

Enzyme Prediction     

No EC number prediction in MGYG000000906_00395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	283	2.5e-57	0.986784140969163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	6.78e-42	40	288	35	315	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	2.65e-32	30	287	72	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	4.76e-31	33	275	1	240	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG4099	COG4099	4.56e-06	30	172	164	301	Predicted peptidase [General function prediction only].
COG4947	COG4947	1.05e-05	144	275	105	224	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA07664.1	2.26e-31	44	286	169	402
BBD44687.1	1.27e-29	28	281	139	383
AWL10512.1	2.30e-29	44	283	157	382
SCD19884.1	5.06e-28	43	283	160	390
ADY36651.1	5.43e-28	33	283	157	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.29e-47	32	285	18	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	9.61e-24	33	286	139	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	1.66e-22	31	281	37	257	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	4.44e-22	31	281	37	257	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	2.62e-20	44	283	157	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.30e-20	31	281	56	276	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	3.04e-20	31	182	505	663	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	1.20e-17	44	287	449	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P9WM38	1.11e-15	30	267	178	427	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	1.11e-15	30	267	178	427	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.023767	0.974695	0.000488	0.000423	0.000307	0.000289

TMHMM  Annotations     

start	end
5	25