CAZyme Information: MGYG000000906_00448

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_00448
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36732.94	8.0938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 74198; End: 75163 Strand: -

Full Sequence      

MKLTKYVYILPLTAALSLTGLVLSGFSVSCAGPETEPSPTYSCIEVPKSISFCGIDIDLT
RYDRRERMDRELMAFTYMHSTSLQIIKRANRYFPIVESILKEQGVPDDFKYLMVIESNVN
PLARSVAGAAGLWQFMSGTARDFDLEVNHHVDERYDVEKSTVAACKYLKQAYRKFGNWET
VAASYNAGQGRISQQQDRQYVDNALDLYLVEETSRYVYRILAAKMLLTNPKQFGFHLRSS
DLYPPIPYRTIKVTEDIDDLARFAKGQGINFSLLKSMNPWLRGTSLPNHSGKEYLIRIPD
PTEMYYNPRVTRPHNPSWVSE

Enzyme Prediction     

No EC number prediction in MGYG000000906_00448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	92	223	4.2e-25	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.30e-64	100	225	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.05e-28	65	299	81	311	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	8.23e-26	95	200	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.81e-21	112	223	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.20e-15	92	222	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24006.1	2.79e-167	1	321	1	322
ADY36030.1	1.62e-150	10	319	13	322
QUT56374.1	1.89e-139	27	321	25	332
QEW35083.1	1.09e-138	27	321	25	332
QQY40386.1	1.09e-138	27	321	25	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.95e-25	65	296	78	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.95e-25	65	296	78	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000968	0.122802	0.876027	0.000062	0.000067	0.000067

TMHMM  Annotations     

start	end
7	29