CAZyme Information: MGYG000000906_01184

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_01184
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000000906_6|CGC2	43284.15	8.633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 81553; End: 82710 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASNLMKALQKNDPAAEFRFFGGDLMAAVGGTLVKHYKDMAYMGFI
PVLLHLRTIFRNMDFCKEDIVGWQPDVLILVDYPGFNLKIAEYIKAHTSIPIFYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEVDFFQKHSYPIHYVGNPCVDAVDGFQRAYSENFAQ
FVARNKLGSKPIVALLAGSRKQEIKDNLSRMIEASRSFPEYQFVIAGAPGIAPEFYRAYM
GENAEIVFGQTYDLLSHATAALVTSGTATLETALFRVPQVVCYYTAAGKLVSFLRRHILK
VKYISLVNLIAGREVVAELVADGMTVENVKTQLARILPSGEGLEQMLQGYERLINLLGEA
GASDRAASQMVECLRQKKNKSSHSK

Enzyme Prediction     

No EC number prediction in MGYG000000906_01184.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	8.3e-109	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.74e-102	1	378	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.45e-96	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.19e-71	4	368	2	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.14e-60	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.15e-45	1	328	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	1.25e-221	1	378	1	378
ADY36062.1	4.57e-209	1	380	1	380
QRQ48683.1	7.63e-196	1	374	1	376
QUT77942.1	9.37e-196	1	376	1	378
QUT45721.1	1.26e-194	1	374	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.52e-35	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.11e-35	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.05e-67	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	3.04e-63	5	378	11	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	3.21e-63	5	367	14	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	1.07e-59	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	2.28e-58	5	376	11	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000906_01184.