CAZyme Information: MGYG000000906_01815

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_01815
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		31217.27	4.6068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 12128; End: 12946 Strand: -

Full Sequence      

MSAKKVLFITQEITPYVPESNLALIGQNLPQAIQDKGREIRTFMPKWGIVNERRNQLHEV
IRLSGMNLIIDDTDHPLIIKVASIQAARRQVYFIDNDDYFQHRQMTCDENGNDYEDNGER
AIFYARGVLETVKKLRWCPDVIHCHGWMSAMVPLYIKKAYYDEPSFRDSKVIYSLYQEGF
KSNLAPNFTDQVLFKEVTQEDVSMMKSPASYEDLCKLAVAYSDGVIQNDETVNQNVIDYA
RSLNIPVLEYASGDAYADACDAFYDKVFDGAE

Enzyme Prediction     

No EC number prediction in MGYG000000906_01815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	226	4e-42	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	1.76e-49	6	241	1	222	Starch synthase catalytic domain.
PRK14098	PRK14098	2.19e-46	5	214	7	223	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.13e-33	5	241	1	221	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	2.17e-26	5	181	2	170	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	9.63e-26	5	177	2	159	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25341.1	2.86e-166	1	272	1	273
ADY34869.1	1.26e-164	1	272	1	273
AND20492.1	4.48e-149	1	268	1	269
QJR63829.1	6.37e-149	1	269	1	270
QJR68092.1	6.37e-149	1	269	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	2.18e-08	6	184	3	175	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNE_A	9.96e-06	6	155	12	156	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.39e-41	5	228	7	238	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4SC83	2.73e-40	5	214	7	223	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
A1BIY8	1.42e-39	5	245	7	256	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3B6C3	3.82e-39	5	230	7	239	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B3QR00	1.41e-38	5	214	7	223	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999170	0.000739	0.000078	0.000004	0.000002	0.000032

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000906_01815.