CAZyme Information: MGYG000000906_01848

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_01848
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		63695.92	6.5879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 50578; End: 52287 Strand: -

Full Sequence      

MKHFGKLLLGACTVLTLTCTPAQMLAQSLSPSTQWEWNKGTIVIKTPERPDGQECALGLT
VPKMNVVRVGFVGLGMRGPGAVERFTYIAGTKIVALCDYEKDRAERCQKLLQKACLPEAA
IYSGAEGYKALCERDDIDLVYIAADWDHHFPIAKYAMEHGKNVAIEVPSAMNLEQCWELI
NLSETTRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHNLDDFWPYYWKNGK
EDKLGWRLRYNKENRGDVYATHGLGPVAQALNIHRGDRMTTLVAMDTKSVHGKALVEKAT
GEPCEEFRNGDHTTTLIRTANGKVIEIQHDVMNPQPYNRLYQLTGTKGFANKYPIEGYAV
DAAQMKASGVQPKVDNLSSHSFLPEKEMQALVDKYQHPILKKYGEMAKEVGGHGGMDFIM
DSRLVYCLQNGLPLDMDVYDLAEWCSLAELGAISMDNGCAAVAFPDFTRGHWNDVKGFHH
AFATPEEEAATELTAETATLALKAQGMKEWLAKSKKADVKKEEVESHIQQLSEQLDKTQK
KANGTESKELKEAVKQAEKMLKQAQKLLK

Enzyme Prediction     

No EC number prediction in MGYG000000906_01848.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	473	2.5e-158	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.98e-21	64	361	1	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.70e-10	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	4.92e-08	67	217	5	145	putative oxidoreductase; Provisional
PRK10206	PRK10206	4.57e-04	136	262	64	212	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24012.1	0.0	1	512	1	513
QCQ31109.1	0.0	5	510	6	511
QJR75586.1	4.68e-309	1	516	1	517
AND19749.1	4.68e-309	1	516	1	517
QEW37947.1	1.83e-308	1	516	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.62e-84	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.12e-66	67	476	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	3.43e-07	65	217	6	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3E9M_A	3.89e-06	103	236	39	167	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	9.07e-06	64	229	3	161	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	5.20e-309	1	516	1	517	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	1.65e-297	1	516	1	516	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	3.49e-243	6	503	5	498	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	6.32e-210	44	483	38	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q5LGZ0	2.29e-208	2	483	3	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000392	0.566837	0.432145	0.000236	0.000210	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000906_01848.