CAZyme Information: MGYG000000907_00904

Basic Information

• Species: Collinsella sp900551665
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900551665
• CAZyme ID: MGYG000000907_00904
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000000907_23|CGC1	39595.01	6.8405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000907	1602935	MAG	China	Asia

• Gene Location: Start: 4073; End: 5122 Strand: -

Full Sequence      

MTEQPQTGNTISNGSSTAPNRIDKLAIVVVTFKRQELLAKLFDSFCGLTRAPWRIVIVDN
EHSEQTRQMVEDLGRRTDELWGAESDAADAEGGTARVVYAPQSDNLGGAGGFSAGVKRAY
ELGAQWFWVMDDDVMVAPEAIERLEPWTHTHRVVQGSRYDYDGGPFYWQYHFIVPLGIPN
PIAPAAFDASGCRTMNTMCFEGGLFARSVVDEIGFPDPRFFIYWDDTVYGYLASKVTESI
VVSDIILQRTRDIPNWDIAGVRQLNGTSDMNRYHIMRNRGYMMQYFRLHGDYNRFLFGLG
TAATFAKEVIRLIAVDHKFKTGMPALFRGMRDARKIYRDKTWKPMPPLK

Enzyme Prediction     

No EC number prediction in MGYG000000907_00904.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	27	213	4.9e-18	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	4.16e-63	28	282	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.93e-22	23	236	3	205	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.74e-14	27	171	2	128	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04186	GT_2_like_c	1.23e-12	27	227	1	141	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	8.36e-12	23	235	2	196	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB06831.1	9.70e-181	4	348	12	356
BAQ31135.1	1.28e-169	18	349	7	337
ALE12246.1	3.88e-168	6	348	10	351
ADP36785.1	5.51e-168	6	348	10	351
BBA47869.1	7.03e-168	6	348	7	348

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	4.39e-15	28	226	10	194	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	1.49e-07	28	133	8	95	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	1.49e-07	28	133	8	95	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000907_00904.