CAZyme Information: MGYG000000908_01737

Basic Information

• Species: Beduini sp900550005
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Beduini; Beduini sp900550005
• CAZyme ID: MGYG000000908_01737
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		28701.26	6.8545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000908	1980396	MAG	China	Asia

• Gene Location: Start: 1059; End: 1808 Strand: +

Full Sequence      

MTKKDKRVMIIAGSDNMLKKIKKILLLILSFVLLITSYLIYKGYVMYDHALVQYPIMQMV
EDICDNENYTTLEELPQMYINAVIAVEDQRYYRHSGIDIYAISRALYHDLLAMSYVEGGS
TITQQLAKNVYFTQEKKIERKVAEVFMAQAIEKVCSKDQILELYLNSIYFGDGYYCVYDA
SMGYFNKVPSQMNDYESTLLAGIPNAPSVYSLSNSPTLASQRQKQVLKRMIKNQYITKEQ
ADAILQSHE

Enzyme Prediction     

No EC number prediction in MGYG000000908_01737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	65	230	1.3e-58	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.87e-73	66	230	12	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.84e-69	69	243	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.23e-64	69	243	78	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.88e-61	69	243	69	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	3.44e-44	71	242	70	241	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET89048.1	1.72e-77	21	244	7	230
QUO38940.1	3.03e-77	19	247	6	234
QNM09777.1	2.40e-76	12	245	8	241
ADL05597.1	2.00e-74	41	244	8	211
QJU22158.1	2.53e-74	21	241	7	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.45e-41	69	240	22	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.74e-41	69	240	22	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3HZS_A	6.41e-32	57	240	8	200	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	6.58e-32	57	240	9	201	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
5U2G_A	7.76e-32	72	245	45	218	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.06e-39	20	241	3	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q5FAC7	1.12e-37	69	245	70	246	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
P0A0Z5	1.12e-37	69	245	70	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	1.12e-37	69	245	70	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
O05131	1.12e-37	69	245	70	246	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999904	0.000111	0.000001	0.000000	0.000000	0.000011

TMHMM  Annotations     

start	end
25	47