CAZyme Information: MGYG000000914_00765

Basic Information

• Species: Fusobacterium_A sp900015295
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900015295
• CAZyme ID: MGYG000000914_00765
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000000914_12|CGC2	40680.29	9.8732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000914	1959286	MAG	China	Asia

• Gene Location: Start: 31283; End: 32323 Strand: +

Full Sequence      

MKILVVRFKQIGDSILTGPLCYSLKKSFPDAQVDYVVYDHIAPLFEKNKYIDNVISITKE
ERKNIFKYIKKVWRVTRNNYDIVIDVMSTPKSELFTLFSRKSKYRIGREKKHRGYTYTHK
IPEPKDAKNKVDKFLKMLKPLEKEYKMKYTEDFSIEIPEEEKLYMRKKMEDAGIDFKRPV
FAVAINSRVVGKVYDINRMMEVIKNIIKYLDPQIVFYYSPNEKEFAKKTHEALNWDKHIF
SNIETKSIRELGMLLSNCTLFFGNEGGPRHLSQSVGIPTFTIYRAGFDIKEWAFQGEKHD
GVGPLDADVNAYSLPADKQNDLITPELVIKKFKDFYRKLIENKEAK

Enzyme Prediction     

No EC number prediction in MGYG000000914_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	299	5.9e-30	0.8711111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.29e-47	1	331	2	325	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.54e-45	2	334	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.32e-16	2	292	7	296	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	3.08e-13	69	285	1	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	3.60e-05	1	124	1	122	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM15588.1	1.55e-252	1	346	1	346
AVQ18455.1	1.49e-171	1	342	1	343
AVQ27645.1	4.13e-143	1	336	1	337
SQJ15718.1	4.13e-143	1	336	1	337
AVQ31324.1	1.18e-142	1	342	1	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	1.25e-13	12	285	5	278	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	7.77e-13	12	285	5	278	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000914_00765.