CAZyme Information: MGYG000000914_01532

Basic Information

• Species: Fusobacterium_A sp900015295
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900015295
• CAZyme ID: MGYG000000914_01532
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		37305.65	9.753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000914	1959286	MAG	China	Asia

• Gene Location: Start: 7507; End: 8496 Strand: +

Full Sequence      

MKILIIRMSSIGDVLLTTPVIKAFKDKYPDAQIDFLVLEQFKDAITGFKYIDKVILFNKK
ENDGLSSIIKFAKTLKKNNYDFVFDLHGKFRSRIICATLGAKTYRYRKRAWWKSILVKTG
MTRYQVDDTIVKNYFGAFKKFDIKYQGEDLEFYYGDNSKFLEYKNLPMLAPGASKETKKW
TTEGFGRLAKLIYEKHGVKSVLIGGKVDIEKCNEIDRLSGGVCVNFAGKLTLKESGAVLS
LGKFLVTNDSGPFHIARGVKCPTFVIFGPTSPGMFDLGQNDTLVYAGVPCSPCSLHGDKI
CPRGHFRCMKEITGDMVFDMIEKKIKWEE

Enzyme Prediction     

No EC number prediction in MGYG000000914_01532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	70	305	4.2e-42	0.9644444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.81e-69	1	326	2	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.23e-66	2	323	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	2.96e-34	2	323	1	331	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	6.74e-30	68	293	1	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.75e-25	2	270	7	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM16240.1	1.00e-240	8	329	1	322
AVQ20051.1	3.62e-165	8	329	1	322
SQJ15109.1	8.16e-161	1	326	1	327
AVQ27557.1	8.16e-161	1	326	1	327
AVQ30467.1	2.71e-159	1	326	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.34e-15	2	322	10	342	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	9.46e-12	1	286	1	299	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	9.46e-12	1	286	1	299	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	9.92e-12	1	286	1	299	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	4.52e-16	12	270	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	5.94e-16	12	270	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
Q57336	1.33e-14	5	272	13	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	9.88e-12	1	272	1	292	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P24173	4.96e-11	1	286	1	299	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000914_01532.