CAZyme Information: MGYG000000915_00413

Basic Information

• Species: Clostridium nigeriense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium nigeriense
• CAZyme ID: MGYG000000915_00413
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	MGYG000000915_1|CGC6	68378.67	5.3259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000915	3503945	MAG	China	Asia

• Gene Location: Start: 456759; End: 458489 Strand: +

Full Sequence      

MKIDLKILDSSVKHIKGKENLINDKNITLEVLKEESFAFQILIKGDMPFFCSLEKNRNIH
WKGLNEKIRIDISGYEEILDMRFLGYVKNDDGSLVGDPILKDKSLFIEEGYQMIWVSLKV
PKEFLKEELNLKIRVYYTKGYEKEELIATESINIKVIDYVMKPIKEGDFYLDLWQHLSSW
ARAYEVEYFSNEHFKIIDNYIKELADLGQKVINLIISDYPWAGQRCYQFEENPSNLYEFN
IVKVSKDKNGNIKCDFSSFDRYIDICMRHGITEEINIFGIICNWDAFSFGNPIKDYYDPI
RISYYDEKEECFDYIRSKDEFIDYLSIVFNHLVEIGLWDKVKIISDEPNNPELFKESVKL
IESAIEGYKVNFKCAIHDEGFFENFGENIQGLSLNTCEAIKTIDKLSEIREKANKKGGRF
TWYSCCFPEDLNIFIKSELIESRLKGWFTYYLDFDGFLRWAYAIWPTNPLKDIRFKYPRW
NAGDMFFVYPGKDLKPMTSVRWENFRFGIQDFNLFKDIQNSGVSKQDIMNEMEKLLGKKE
DMKYIKERKIKLIYSKEYIKYIDIRNSLIKKLLLNN

Enzyme Prediction     

No EC number prediction in MGYG000000915_00413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	88	543	1.1e-88	0.7788104089219331

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	1.55e-25	453	516	1	63	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM57903.1	6.68e-306	1	576	1	575
QZY54933.1	6.75e-275	1	574	1	576
CEJ73820.1	2.01e-220	1	571	1	571
CEK38295.1	8.05e-220	1	571	1	571
QYE96546.1	4.01e-218	1	571	1	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FQE_A	2.44e-33	97	536	129	557	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	4.44e-33	97	536	129	557	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000915_00413.