CAZyme Information: MGYG000000915_00861

Basic Information

• Species: Clostridium nigeriense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium nigeriense
• CAZyme ID: MGYG000000915_00861
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000000915_2|CGC3	38057.9	4.6164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000915	3503945	MAG	China	Asia

• Gene Location: Start: 253298; End: 254299 Strand: -

Full Sequence      

MIRLLSKAGGEALQYKGTYKGLNDITKSYLDSKTNKMILSLIFILVLVITTFIATFKLIG
VSKDEIYLSKEEIQNYINIADELSKDGYQINWQEIASINFVLNNESFEINENNITKIEDV
LLKKDKDGNVVGINNFKDSIKRLNFNSEQVELASKNLKTLKNNYINDKLPKDEEKLEFIE
SVSEIAFDNYKNYGVLPSITISQAILESGWGESTLSEEYNNLFGIKADSRWSGKTAELET
KENYDDVIVGAFRAYDSFKSSIRDHGKFLYENERYAKNGLFEGKTYKEQAQALENAGYST
AKDEEGNLIYADKLIRVIQENNLMLYDNLVEQK

Enzyme Prediction     

No EC number prediction in MGYG000000915_00861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	185	323	6.8e-37	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.32e-48	174	328	42	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	5.83e-30	194	319	171	295	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	2.44e-26	178	327	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	6.26e-24	184	323	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	5.76e-22	168	327	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSW19705.1	8.06e-96	46	332	39	327
QBJ75012.1	3.55e-90	13	332	1	320
ATD57589.1	3.55e-90	13	332	1	320
SLK15979.1	3.55e-90	13	332	1	320
ATD54730.1	3.55e-90	13	332	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	6.59e-19	178	323	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	8.16e-19	178	323	5	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	5.70e-18	178	323	5	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.77e-15	178	327	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	3.87e-15	194	324	22	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.03e-22	173	329	46	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.75e-17	178	320	163	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	9.31e-17	178	326	164	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	4.27e-15	177	300	241	370	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P75942	4.80e-14	158	320	135	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999954	0.000075	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59