CAZyme Information: MGYG000000915_02018

Basic Information

• Species: Clostridium nigeriense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium nigeriense
• CAZyme ID: MGYG000000915_02018
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292	MGYG000000915_6|CGC9	33670.4	4.4889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000915	3503945	MAG	China	Asia

• Gene Location: Start: 201000; End: 201878 Strand: +

Full Sequence      

MKKIFTIILWIAIIILIILGGKYLYNKEYEKNKVEDANSNEVIENEDKDIEVQEEKLPKK
NENDYVTLNINDVRIPILMYHSISDADPNNSLLIPVKQFEEQIKWLKESGFTPMLLDDIV
EAYTTGYVPKKPVAITFDDGYSDNYTDAYRILKENNMKGTFFIITNNIDADGFYMNSAML
KEMKEGGMGIENHTSRHIEFTNISRDDKANIIVEGINELKEKVGVDSKYICYPVGRYDEE
TIEVEKEIGIKAAVTTEYGISSINDGLYSLKRVRIFPMDIESFKNIFKDFLN

Enzyme Prediction     

No EC number prediction in MGYG000000915_02018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	127	258	3.5e-30	0.9615384615384616

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	3.43e-52	132	277	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	1.19e-36	97	273	2	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	1.12e-34	75	254	1	184	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam01522	Polysacc_deac_1	2.57e-34	128	253	4	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10966	CE4_yadE_5s	3.91e-33	129	283	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY56017.1	8.12e-42	74	276	85	285
QZY32711.1	7.75e-40	74	277	64	264
AEG61805.1	6.90e-35	74	275	42	258
AFC32947.1	1.64e-34	73	284	33	242
AFH65258.1	1.64e-34	73	284	33	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	1.57e-32	73	277	7	217	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
5BU6_A	2.44e-12	77	272	15	260	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
2J13_A	5.28e-11	126	249	50	170	Structureof a family 4 carbohydrate esterase from Bacillus anthracis [Bacillus anthracis str. Ames]
4WCJ_A	1.56e-10	77	277	39	250	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
7AX7_A	3.52e-09	130	233	3	102	Crystalstructure of the Xyl-CE4 domain of a multidomain xylanase from the hindgut metagenome of Trinervitermes trinervoides [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	7.03e-42	74	277	64	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q04729	1.31e-08	122	251	58	184	Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus OX=1422 PE=3 SV=1
O34928	1.42e-07	116	249	48	181	Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) OX=224308 GN=pdaA PE=1 SV=1
P75906	1.71e-07	78	153	52	129	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	1.71e-07	78	153	52	129	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.760266	0.230524	0.007388	0.000477	0.000343	0.001007

TMHMM  Annotations     

start	end
4	26