CAZyme Information: MGYG000000915_02211

Basic Information

• Species: Clostridium nigeriense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium nigeriense
• CAZyme ID: MGYG000000915_02211
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
993	MGYG000000915_8|CGC1	110366.31	4.708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000915	3503945	MAG	China	Asia

• Gene Location: Start: 11914; End: 14895 Strand: +

Full Sequence      

MTFKKMKRLVAQFLIVAFMIPNFNVMAATKEINTVLEKENTSIQTATEEKFSEEVNSETQ
NANVNEDEKTDSVNKEESNKNEEVANKEDSVKEENIIENNEKKDTTIESEKDNDTSKEVE
SNTQGIEEDKSIKEKQEDSVDTLKGKKYEKRKAVNSIARSSISMFSLQEEEREEFRLKKE
ALENLEVLEPMTEKEYELTIANYDGSYEFVEAYDNLEEAVSSAKTLEASVTEGQEPAIIN
YSGQVVYSTNQMARIIKYSNNSVISGTVNMYTDSSMQKEFTYINPSYMDDAPVLDMNGTA
AKVMINGYEGWINNDKASGTYDMIIVPVTTVSNPSYYTVKNGELVHFISYDLTGNTGYNK
VLGKAPFFLKEGVRYLSYDGKYFYQYNHNDRNDLASKLNLLINNYRAGVRTNAVNSGSPY
YIYYLNLPFRSQTVYSADDLNRYINANTEVDSKLRGLGQAFKEAETTYGVNALLALGVSI
NESNYGISTIAKTKNNLFGLKAYDSAPGESADIFATPRDSVIDFAKNWISRGYADPADWR
YFGGFLGNKNRGANVKYASDPYWGEKATSFAYEVDKYLSGGNTNLRDTNSKQIGIATSNN
SVIKSNGALLYNITNDINQYGAYINTPFVISNLQQVTINGKKYYEIYPERNTPVGAGGAS
NKFSGNYNWNDKGYIEAKSISFTNEYIPPVEVQYGLSRYDTAVEVSKSQFTSSETIVISN
GYAIPDGLTATPIASYYKAPLLLVDTNSVPVATQNEIKRLKAKNVIIVGGTGVVTPAVEK
QLRNIGITKITRLGGLDRYATALQVAQYIDSNLYDVEKVVIANGYGEPDALSIAPVSGRD
RMPIILVEDNYIPTNVKNWLKSEDLNTAYIIGGTGIISNNVLNQVNSMTRQNIVNNRLGG
IDRYETNARVIERFYGELVNKVYVTEGTALADALTAGPVAALNESPVVIADYLVSGIQRT
VLDNKRTNSIVQVGGVVSKIIVEDLRKLLKSVQ

Enzyme Prediction     

No EC number prediction in MGYG000000915_02211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	458	572	1e-18	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033435	S-layer_Clost	8.20e-29	580	980	261	722	S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.
pfam04122	CW_binding_2	3.63e-20	792	880	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	6.02e-18	694	777	3	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
COG4193	LytD	7.23e-16	413	580	59	234	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
COG2247	LytB	2.07e-14	701	831	17	147	Putative cell wall-binding domain [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSW17879.1	4.57e-272	250	993	35	770
ASW42466.1	1.60e-164	139	698	84	679
QAS62016.1	8.42e-153	170	684	57	575
AYE33874.1	8.42e-153	170	684	57	575
CEI73319.1	1.07e-150	180	983	58	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	5.99e-58	676	974	114	419	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
5J6Q_A	4.15e-36	690	985	286	587	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
7ACX_B	3.26e-31	681	989	32	371	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACY_B	4.40e-31	681	989	32	371	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]
7ACZ_B	1.91e-28	681	989	32	412	ChainB, SLPH (HMW SLP) [Clostridioides difficile R20291],7ACZ_D Chain D, SLPH (HMW SLP) [Clostridioides difficile R20291]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	1.31e-33	695	951	33	276	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
P59205	3.76e-24	433	580	515	656	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	4.38e-24	433	580	559	700	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1
Q02113	1.64e-22	695	948	67	302	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
O58348	1.14e-07	714	872	29	186	Uncharacterized protein PH0614 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH0614 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000388	0.998862	0.000264	0.000157	0.000162	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000915_02211.