CAZyme Information: MGYG000000915_02509

Basic Information

• Species: Clostridium nigeriense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium nigeriense
• CAZyme ID: MGYG000000915_02509
• CAZy Family: CBM27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1147		126925.5	4.4004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000915	3503945	MAG	China	Asia

• Gene Location: Start: 152511; End: 155954 Strand: +

Full Sequence      

MLRRKFKNLSFLVSFMMACSMLPKPNITYAITNDTAIYTNDFESSLLPDEVGGVITKQNV
SIKDLDGNKFMSFNAKFDGTDNWDNNKHEFSFFTESNNHIEADTKVKFNLLIPTEKKNFN
GIIKYGTGSSDSSWGWVGGSYGDLTSDKFVDLGNGYSRVEVETSIGESNGLKKLVLQIAA
YNCDYSGEILIDDISIIASEKEEIELPSVKPIEWNFDNESIGIGSWKYGGGYQYSSGEPK
ISYDKTVGAGSIRLDVDYSKDSKITWSEVKLQNDLSEPINFNGYNKLTYDFIYDSSKMTT
GGFKTKLYIENAVNKDMDINLDNAEDLGNNLKKVKVEVDFNSKNVGINSIILSTVGVSTS
YVGPIYIDNISFGQTVSEDVYVVKTSEIKPQSVIDVSTLDVDSSVRLVDKNSTNTTAKLY
AYLKAVGKEDKALYGHQNDTHHKAVLKGVGSNSDTKDLTGSLAAIVGIDTLSLTGAELQL
SDEDIANGVTLPKKAAQLGIDAANEGSIITMSAHMPNFALVAEKGKNSNGSYDYSGYTPG
ITTGDVVSRIMPGGDLNEVYTGYLDIIAEYANTLEEEGVPVLFRPFHENNGSWFWWGKAF
CDEEGYKNLYRYTVEYLRDTKEVHNFLYVYSPNGPFENEKDYLSRYPGDEFIDVIAFDMY
HDNPIENAEEDTWMNSLRETINLVQGIANKRGKLSAVSETGIRKNYGCMPVSGNPNKNWF
SDVSNIVAESNMPYYMVWANFDEGNIFAPYMINENKGHEMINSFIDYYNEESSVFADGVG
DYKSVSTTIGEEYSYGYITSPASRSRILNSTKITARIRNLNGEVKFVLRDNLGNEIKTLK
ATLNNGSYEADITKEVLDSIGEKTGIIELCVGNKVVNTISAIFNIKEKEAPKELVDDFEG
YYGESVLLENNWATNVGPGCSLTPTLVTEEGKFNEGKYGLAFNYKISTEKTSEGWAGMTK
AIGQDWSEFDALQFWVYPDGKAQKLVIQITTNGEDFEVFLPELAGTTEPKLVKLKFSDFV
GKNGGTIDLSSVERFGIWCNTIVPEGNVGKWTVESTIYFDSIKAIDTTKPQEPSKPGTEE
PSNPGASEGNGGNNEIEDIEVPNNSKDEGSKSEDNWNLPNTGGVSPIIPLTLGSALIYMG
SIIRRKR

Enzyme Prediction     

No EC number prediction in MGYG000000915_02509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	408	740	1.1e-58	0.9042904290429042
CBM23	895	1064	4.9e-37	0.9814814814814815
CBM27	215	372	1.3e-24	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.53e-41	408	668	1	238	Glycosyl hydrolase family 26.
COG4124	ManB2	3.81e-21	512	701	118	296	Beta-mannanase [Carbohydrate transport and metabolism].
pfam03425	CBM_11	1.80e-10	889	1020	1	129	Carbohydrate binding domain (family 11).
pfam09212	CBM27	3.20e-09	213	372	12	170	Carbohydrate binding module 27. Members of this family are carbohydrate binding modules that bind to beta-1, 4-manno-oligosaccharides, carob galactomannan, and konjac glucomannan, but not to cellulose (insoluble and soluble) or soluble birchwood xylan. They adopt a beta sandwich structure comprising 13 beta strands with a single, small alpha-helix and a single metal atom.
pfam08547	CIA30	1.21e-04	946	1037	42	142	Complex I intermediate-associated protein 30 (CIA30). This protein is associated with mitochondrial Complex I intermediate-associated protein 30 (CIA30) in human and mouse. The family is also present in Schizosaccharomyces pombe which does not contain the NADH dehydrogenase component of complex I, or many of the other essential subunits. This means it is possible that this family of protein may not be directly involved in oxidative phosphorylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUF84291.1	0.0	28	1071	91	1132
QSX03803.1	0.0	28	1071	91	1132
QJU44978.1	0.0	28	1071	91	1132
QCJ07246.1	0.0	28	1071	91	1132
APF23747.1	0.0	28	1071	91	1132

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YN5_A	1.99e-64	404	801	48	441	Catalyticdomain of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase [Bacillus sp. JAMB750]
2BVT_A	4.74e-58	402	818	3	396	Thestructure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVT_B The structure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVY_A The structure and characterization of a modular endo-beta-1,4-mannanase from Cellulomonas fimi [Cellulomonas fimi]
2X2Y_A	2.52e-56	402	818	3	396	Cellulomonasfimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi],2X2Y_B Cellulomonas fimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi]
1J9Y_A	5.07e-55	404	775	8	369	Crystalstructure of mannanase 26A from Pseudomonas cellulosa [Cellvibrio japonicus]
1R7O_A	6.56e-55	404	775	18	379	CrystalStructure of apo-mannanase 26A from Psudomonas cellulosa [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	5.38e-58	403	1077	38	714	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	7.23e-54	404	775	46	407	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
P16699	2.33e-18	407	664	34	274	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
O05512	2.86e-16	404	660	28	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	2.89e-15	528	664	131	270	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000738	0.569346	0.429005	0.000349	0.000299	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000915_02509.