CAZyme Information: MGYG000000916_00137

Basic Information

• Species: Lactobacillus porci
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus porci
• CAZyme ID: MGYG000000916_00137
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1004	MGYG000000916_2|CGC1	113026.69	6.7928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000916	1647230	MAG	China	Asia

• Gene Location: Start: 27534; End: 30548 Strand: -

Full Sequence      

MTADLQNSRHQLGRLVGVNKRENYYELHYATGEIARVYLIANGIFRYWLDPSQEFAETDD
MLVHGIQPDPQCFARATAHATSDMFIINAGSCKLIFQQKTSLFSIFDEAVHRTRLAQAAP
LELSGKHAIEVLKQNQNEYYYGGGVQNGHFCHKGDKLLVKTDGITGKDGVLAGVPFFWTN
AGFGELRNTKSKGIYDFSASHGQAALLRHRSPVFDAFYIIGNSPQEILNKYYSLTGKPLM
LPKYALGLGHLGNFIDPVWTAAKGKKHDAIRFEDNSYYSRGDADGKELTYHASLNGEDKY
QFSARAMIDRYHRWDFPLDWLIPNYEAKQEADHDSYAAFASYAKEQGVHPGFWTEDDLTP
PNHSESLAIDNPEADLNEARENLVKENPKQKPLVLVRDSLRPFQSEAVLAYGDIGGDWTA
IKTQVATLLGAGLSGLPFLGAAVNGKIGGDNAQMAIRDLEWKVFTPLLFVMDDQSRFSKT
PFAYNNKISKIMQAYLRLRKRLLPYLYNLARQAQDGESLVRPLFMEFPHEQICYGSSFGD
EFMLGPQILVAPIVSGKADSQGVSVRDHIYLPDKQTIWIDLFTGERLMGGRVYNRRKYPL
WQLPVFVRGGSIFELGDRNFVFYPQGDSTYVSYNDDDLQDYRHNWATTTIRTHLAESSLK
IIIEPTTGYYPDLAIKQGATLKVFCDHHPEEIRLSVDGESSKLEEYGTPETLARAKEGYY
YDNKFSWTPEFTDLGAGPRKALIIKLAERDIKQSKIELSISNFHFANEQLVHQITDAALR
LPGRFELDSSKTSAHSLTVKWNQRTPMVQIEVNGLLYTGIPGNIFTFTDLAANKDYKLRL
RYESGYKVSEWSDFIQAKTKRDPSDYIITGVKAAASAASRPGHPVKYLLDKREATDWQTA
QTPTAEEPVTLTFAFPQQVELSKLIYVPRALDKEGRPLKMRVEVSTDGLTFNPYGGDYEF
NADCKNKVIGLRGVSAQAIRLSVLEATGTGLGASSINFYRPIQN

Enzyme Prediction     

No EC number prediction in MGYG000000916_00137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	378	612	9.7e-54	0.522248243559719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	3.70e-65	234	584	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	6.34e-53	81	670	100	744	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	4.73e-49	217	612	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	3.64e-29	412	618	234	431	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06592	GH31_NET37	1.10e-22	416	573	213	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL26871.1	0.0	1	1003	1	1001
APG70780.1	0.0	1	1003	1	1001
APG72685.1	0.0	1	1003	1	1001
ADQ60230.1	0.0	1	1003	1	1001
ARR37778.1	0.0	1	1003	1	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F7R_A	3.10e-159	4	863	29	961	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6M76_A	4.35e-159	4	863	29	961	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7Q_A	4.35e-159	4	863	29	961	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR6_A	1.22e-25	6	727	24	814	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	1.60e-25	6	727	24	814	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	9.01e-30	6	698	19	768	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	5.25e-29	173	619	151	628	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9FN05	3.53e-23	166	618	281	784	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
B9F676	1.06e-22	168	618	285	782	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q8TET4	2.53e-20	381	612	554	778	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000916_00137.