CAZyme Information: MGYG000000919_00562

Basic Information

• Species: Niameybacter sp900551325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900551325
• CAZyme ID: MGYG000000919_00562
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	MGYG000000919_2|CGC1	97140.08	5.1176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000919	4175004	MAG	China	Asia

• Gene Location: Start: 155794; End: 158385 Strand: -

Full Sequence      

MFKYPFQNPNLSIDERIEDLISRMTLEEKVRQLDIYSWNEFKEDDGQFNFEKFKTVSGKE
GVGCLQNRYSSAEENNKIQKLHLEEARLPIPILFSEEALHGLIWPGCTVFPQQIALASTF
EPELGYEQGKAIARECRSLGIHETWSPVLDLARDPRWGRVEEAYGEDTYLASRFAEEMVK
GLQGDDLTKEDSIIAEVKHFSGYGAPTGGLNCAPAMMGKHEHEFYCVPVFEAAFKAGALN
AMCSYNSIDGIPVAGDRKLLTDKLRGELGMKGFVRADMTAIIMLHRCHYVVESQREAIKM
AIEAGIDMQLYDFPHEVYQGHLIDMVRVGELDEAVVDLSVSRVLRVKFMLGLFEKPYVDE
NLYKKVVHCEEHIELAREVGKKAICLLKNHNNILPFKKDIKSIAVVGPSAATPRFGDYSA
PTNTCKSAVTLLDGIREAVSKDTEVLYAKGCDILDREVMVVPSKWLQTIEGKEGLTGQYY
NGVTFTGEPVLTRIDPEINFNWIYTKPGEGIQSDSFGVRWTGVLVPEETFNGYIGLSSMD
SMRLWIDEELIIDGWKEKSANQMKPFVFEKGKTYSIKIEFINDQRGVRVIFGFNRGNEDL
EKAIDIAKRAEVVVVAVGDSEETCGENLDRAELNLPGRQLELVKKIYETGTPVILVLQNG
RPLSITWEQEHLHAIVEAWHIGEQGGRALADILFGVVNPGGRLPISFPKSVGQIPVHYNR
RPFGATKYVEMDWNPLYPFGFGLSYTTFKYSNLKLSAKEIEASETMKVSIDVTNVGQCYG
EDVPQLYIHDDVSSVVRPYKELAGFKRIGLAPGETKTVTFELGERQLRVLNPEFKWVVEK
GSFEVMVGPNSADLPFTAKFRVK

Enzyme Prediction     

No EC number prediction in MGYG000000919_00562.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	84	310	1.3e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	5	853	23	756	beta-glucosidase BglX.
COG1472	BglX	1.47e-89	24	453	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.23e-76	4	848	40	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.42e-67	25	346	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.65e-56	384	745	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98992.1	0.0	4	862	9	869
BBI31696.1	0.0	6	862	11	879
QAY68112.1	1.01e-314	6	862	9	876
AXP81467.1	1.42e-273	3	854	23	872
APA00260.1	8.06e-269	3	862	28	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.35e-133	13	863	10	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.83e-132	13	863	10	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.00e-128	6	863	7	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
6R5I_A	3.21e-128	17	852	7	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	7.63e-128	8	852	29	755	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.69e-133	87	863	62	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.41e-128	14	852	35	755	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.69e-128	14	852	35	755	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	4.25e-123	6	863	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P27034	9.29e-95	110	854	61	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000919_00562.