CAZyme Information: MGYG000000919_02279

Basic Information

• Species: Niameybacter sp900551325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900551325
• CAZyme ID: MGYG000000919_02279
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		65185.59	4.9356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000919	4175004	MAG	China	Asia

• Gene Location: Start: 81774; End: 83489 Strand: -

Full Sequence      

MKEKFKKLGLKPYGPVPSERQMEWYRREATAFFHFGVNTFLDLEWGNGTEKEAWFNPTEL
DCRQWIRVIKEAGFTAAILTAKHHDGFCLWPSKYSEHTVAQSPYKGGKGDVVREFVDACR
EYQVKPGLYLSPWDRHSEYWGSDEYNIYYNNQLTELMTEYGQICECWWDGAGSTEANYDW
GRWAYTVRAYQPKCIIFGSLGATEYVEARWVGNESGYAGNPCWATIDASSLLVENTSELN
VGKPDGNRFIPAEVDVSIRPGWFYHKEQDHAVKSPQNLVKYWFESSGRNAGILLNFPPDR
RGIIHEIDEANVLEASRILKQTFAVNQLVGAKVTATTMRDPSCSPEKLLFKDNELFYASA
KGDLNPVIIFKTKKEIEFDCLVVSEVIELGHRVRGYKVEARVNNEWVCLVENECIGFRWA
ERFDRVSTNEVRLTITSAVAEPVLRSFGVYKMEEAKTEEIASTTSPMNLMELSTTQAIIS
GNILEIEFGGIFPFDTLEICPKAVKQYTFFIFNGTQYEAICSGEQNENTQIQEFEKQEGS
YKVKLVFEPQDGLNLADIKSGLGIKIYNKNP

Enzyme Prediction     

EC	3.2.1.111

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	19	320	1.1e-73	0.8641618497109826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	9.41e-64	9	450	3	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	6.78e-31	55	314	79	323	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	8.28e-29	23	314	45	325	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT72454.1	1.53e-152	12	451	27	477
AAO77299.1	3.50e-151	12	451	27	477
ALJ40425.1	3.50e-151	12	451	27	477
QMW84652.1	3.50e-151	12	451	27	477
QUT40278.1	1.99e-150	14	451	29	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EYP_A	9.61e-154	8	451	1	455	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	5.04e-107	16	524	31	537	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	2.52e-101	5	479	27	495	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6ORG_A	1.61e-100	10	451	4	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	2.43e-99	10	451	4	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	7.09e-101	12	450	33	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.51e-99	12	466	35	492	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9VTJ4	2.91e-08	55	178	107	237	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
Q6AYS4	4.46e-07	40	320	81	353	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q9BTY2	4.53e-07	55	320	107	361	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000919_02279.