CAZyme Information: MGYG000000919_02449

Basic Information

• Species: Niameybacter sp900551325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900551325
• CAZyme ID: MGYG000000919_02449
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000919_12|CGC1	43548.14	4.4015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000919	4175004	MAG	China	Asia

• Gene Location: Start: 20363; End: 21523 Strand: +

Full Sequence      

MNLNKKFLSALCMAVVMVGGSAVYAAPTKPTLKMEQQTDHTVVLSLENFSEQTARGIQIE
VTAKEKIDDTITFEGKNKEVDQFIKVDGQQLTFYFVDDAPLFDVPTIELGYIKGLEGMEF
LDTATIKVVDKDFVSTEWTDVQLQYVVDSEQEPTPEPTPEPEPETKPESKPESKPETKPD
TKPETKPETKPETKPETKPETVPTFVDTTGHWAEQDIQKMVQKGILKGYEDGTFKPNASM
TRAELATVIDRIFEFDEKLEFLPFTDVDYNKWYTKAVSNLYARGIVNGRVDGTFGLVDHV
TNQEAVVMLYRTLESLDIQLEKQRSYTNFKDQATISGFAKDAVQNFYETGIISGTPEGNF
YPQQSISRAQIAIMANRILEKIETVR

Enzyme Prediction     

No EC number prediction in MGYG000000919_02449.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
SLH	206	244	7.8e-17	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	2.16e-15	192	372	569	745	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
NF033190	inl_like_NEAT_1	8.69e-14	194	313	632	752	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	6.24e-10	206	245	4	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	4.30e-09	227	380	542	692	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	5.13e-08	329	370	1	41	S-layer homology domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG58478.1	2.55e-31	212	382	1431	1601
ANY67270.1	6.44e-30	209	381	1068	1239
ANY70239.1	1.24e-29	212	379	1357	1524
QGU00318.1	2.25e-29	211	381	42	207
ABN54008.1	9.73e-29	210	382	35	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT4_A	3.00e-13	211	372	33	189	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	3.06e-13	211	372	12	168	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	5.47e-19	211	381	1688	1857	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P19424	8.44e-18	212	382	49	217	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
C6CRV0	1.76e-16	212	378	1291	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
Q06852	4.57e-14	223	381	2101	2266	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
Q06848	5.24e-14	213	381	223	400	Cellulosome-anchoring protein OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=ancA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999076	0.000171	0.000162	0.000158	0.000137

TMHMM  Annotations     

start	end
7	26