CAZyme Information: MGYG000000919_03770

Basic Information

• Species: Niameybacter sp900551325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900551325
• CAZyme ID: MGYG000000919_03770
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000000919_50|CGC1	45786.21	5.0134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000919	4175004	MAG	China	Asia

• Gene Location: Start: 1121; End: 2335 Strand: +

Full Sequence      

MKRLLALILSLVMVLSVTPIFASEPAKVEGQKKVITYLPCWGSRQWKVEDIQGDKLTHVY
LSFARIDNDFEISNTEMRIHTVGGQYAMPDIVSEKMIIDETWTKVAQLQKKYPHLKFIIA
VGGWEADGFSDMAANAANREIFVDSAVKYVKEHNLDGIDIDWEYPVNGAWGVIKSRPEDK
ENFTALFKLLREKLGKDKEISFCANVSNWFFDAVELDKLVPIIDSVNLMTYDMRGNWEAS
AFHSAGLYRNPAEPQDWGLSVSETVDRFLNHGVPADKLIVGVPTYGKEFRNVEAGANGDG
LFQPFVTDAEGKMTTDKGTWVSSIPYSKLKAYFVNKNGFKRHWDDIAKAPYLYDGKTFIS
YDDVDSIKAKAEYIKEKDLAGIMYWEYVNDIDGELLTVMSNTLK

Enzyme Prediction     

No EC number prediction in MGYG000000919_03770.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	31	394	2.4e-74	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.94e-103	34	390	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG3325	ChiA	3.21e-89	31	399	37	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].
smart00636	Glyco_18	1.42e-88	33	386	1	330	Glyco_18 domain.
pfam00704	Glyco_hydro_18	4.00e-76	33	390	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.62e-71	48	385	20	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEP78394.1	4.57e-158	33	404	29	386
BAM67143.1	1.72e-92	16	396	545	916
AIF50201.1	6.27e-90	2	404	3	383
AEW53599.1	3.33e-83	2	390	4	450
QKH04282.1	3.33e-83	2	390	4	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZU_A	3.68e-97	24	396	18	383	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	6.10e-95	16	396	263	634	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6BT9_A	2.24e-79	32	390	37	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6KST_A	1.35e-74	30	403	5	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	3.57e-74	24	404	2	416	ChainA, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	7.23e-73	2	404	11	448	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9D7Q1	7.56e-48	33	392	23	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
Q13231	5.76e-47	33	385	23	358	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
E9ERT9	4.96e-46	18	403	23	399	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
P36362	1.29e-44	29	393	20	379	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.998977	0.000187	0.000176	0.000167	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000919_03770.