CAZyme Information: MGYG000000920_00982

Basic Information

• Species: Gemmiger sp900548355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900548355
• CAZyme ID: MGYG000000920_00982
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	MGYG000000920_8|CGC1	55114.94	4.4119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000920	2473301	MAG	China	Asia

• Gene Location: Start: 26139; End: 27650 Strand: -

Full Sequence      

MPQIVKLSPAELKTLRTVDDRLMSYNIEMAEVTGGTFWKAYTPAQIAGTEEVPPITKLSI
DSDGPMQVYPPIDLYNEKLRKLARDLGPVWVRVSGTWASKTYYDFDGAGVTPEGYLNRLT
KEQWIGVLDFCKAIGAKLMISVANCPGLHSVEEPWNPSEAEKIFSLSRDYGVPIDAAEFM
NEPNMLSYSGAPEGYTAADYARDQDLFFAWLRKNYPGCLCVGPSNTGDETMGPTTGKKQS
HGGGVADIFSNNATCDELMDGTQEKLDVYSYHYYNGVSERLQSIMPAAHWQADQATTEAY
LAVAANSCKMNIPLRDKYCPGGQMWVTESGDAGGGGDTWASTYLDVFRTLNELAEFSTLT
DGIIFHNTLAASDYAFLAREVFDPRPNYFAVLLWNRLMGTTVYDTGEPAREGAHVYAHSR
KDGQSGACYLIINNSTTDATTVELPQDAVRYTLSADALRSPVMKLNGRELVLGENNALPD
LSGEAQPAGTLTVEPATIVFLVV

Enzyme Prediction     

No EC number prediction in MGYG000000920_00982.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	70	503	1.4e-70	0.945054945054945

CDD Domains     

MGYG000000920_00982 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	3.58e-258	1	502	1	508
SNU86930.1	8.64e-235	1	502	1	506
AXI08463.1	2.29e-229	1	502	1	503
QGS68324.1	2.29e-229	1	502	1	503
QTH47273.1	2.76e-222	1	503	1	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	7.42e-08	130	503	20	378	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5LA4_A	1.66e-07	74	496	41	492	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LRC8	6.09e-15	72	501	73	510	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
B2RY83	6.15e-08	318	503	371	581	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1
Q8WWQ2	6.15e-08	318	503	371	581	Inactive heparanase-2 OS=Homo sapiens OX=9606 GN=HPSE2 PE=1 SV=3
Q6YGZ1	1.33e-07	74	496	67	518	Heparanase OS=Mus musculus OX=10090 GN=Hpse PE=1 SV=3
Q9Y251	9.47e-07	74	496	75	526	Heparanase OS=Homo sapiens OX=9606 GN=HPSE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000920_00982.