CAZyme Information: MGYG000000920_01693

Basic Information

• Species: Gemmiger sp900548355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900548355
• CAZyme ID: MGYG000000920_01693
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1147	MGYG000000920_23|CGC1	126676.96	5.2498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000920	2473301	MAG	China	Asia

• Gene Location: Start: 7796; End: 11239 Strand: -

Full Sequence      

MIRNDFNHDWLFAEAAPGAPRPEPSAFVPVDLPHDWQIRHAGDLYRDSTGYYVKTFACAP
APGERVALWFGGVYMDTAVFVNGEPAGQWKNGYTSFWLDITEKLHSGQNEVLVRCDLRHP
NSRWYSGAGIYRDVELWRMPAQHLMPDGLYVAAREGEGGAWQVQVSAEVGLCAGAAAEGE
MELRLYDPEGALLETRRLPAACWQPGAGGQAWRTGQESEILLASATFSLQNPRLWDLDAP
FRYRLEAVLTGAAPDSLETSFGCRTIELSPETGLWLNHRQVYLRGVCLHHDLGCLGAAFE
PDAAARQLRTLKAMGVNSIRTGHTVPAPGLMELADTMGFLINDEIFDCWRSPKNPFDYAR
FFDAWQARDVAAWVRRDRNRASLLFYSIGNEIYDTHAGPEGADTMRLLLAEVAEHDPAGN
GTPTFGSNYMPWENTQACADIIKVVGYNYGERLYDEHHAAHPDWLLYGSETGSLVQSRGI
YHFPLAQSTLSDDDEQCSSLGNSRTSWGAESLDLCLTTERHSPYTLGQYLWSGADYIGEP
TPYHTRNSYFGMIDTAGFPKDAYYVCQAAWLDPDTQPMVHLFPYWDWNPGQTIDLCACTN
AHSVELFVDGQSLGRQTPDPDKGRTAAWQAAYRPGVVRAVAYNADGRPVAETEIRSFGDA
AALQIQADRTRLSGSGAELAFLTVRALDAEGVPVANANDRVTLRVQGAGVLVALDNGDST
DPDEYQTSSRRLFSGQLLAVVAGDGREGEMTVEATAPGLRPATITLHTDPYQGPARRRLP
PLPAAADPVKVPLRKLELHADRTRLTPFYRKAVVTARRYPAGATAGEAIQWKITDDRGDT
ATNAKIMVQGDTATVEALGDGPLRVRAMACNGRRVPQLISQLDLKVHGLGQLHMNPYQFV
AAGRYEASYGDIGNGNERGISTSRTGRSWVLYNDIDFGPDGSDKVQLPIFSLDGEPTPIR
FWDGEPYVMGSEMIGERIYHKPKMWNVYQPETFRLSKRLTGIGSFAVELNTKVHIKGFQF
YPHSRAWDTLAAGACDAINGDSFTRAGAQVLGIGNNVSLVFRRMDFGEEGCRGVRLRGRS
SLPANTVHLLFEGEGAALPTERRVVEFGPQPEWGEQSFTFAPVTGRRQVTFLFLPGTQFD
FDSFTFF

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	567	7.7e-89	0.6023936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.21e-50	3	750	27	760	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	8.36e-37	663	765	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	6.10e-21	22	417	46	441	beta-D-glucuronidase; Provisional
pfam16355	DUF4982	1.35e-19	590	652	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
PRK10340	ebgA	3.29e-19	19	391	55	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34875.1	0.0	1	1146	1	1147
AET60078.1	0.0	6	1146	9	1139
AGA58497.1	0.0	6	1146	7	1139
QZN78011.1	0.0	6	1146	7	1160
QUL53148.1	0.0	2	1146	3	1158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CWD_A	1.06e-158	1	768	1	801	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.65e-154	3	768	9	807	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CU6_A	2.84e-127	5	773	17	849	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	7.69e-127	5	773	17	849	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
5T98_A	5.81e-123	6	769	30	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	3.98e-140	3	769	44	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	4.45e-76	2	736	47	788	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.66e-40	30	619	82	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	4.06e-29	5	770	30	797	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	8.97e-19	5	712	7	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999814	0.000210	0.000007	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000920_01693.