CAZyme Information: MGYG000000920_01722

Basic Information

• Species: Gemmiger sp900548355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900548355
• CAZyme ID: MGYG000000920_01722
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	MGYG000000920_24|CGC1	69137.48	5.1426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000920	2473301	MAG	China	Asia

• Gene Location: Start: 18892; End: 20751 Strand: +

Full Sequence      

MNLLPKPKRVEPGQGTFAFGISTAIRLTFGTAPGALLYAQMLQQTLEAETGLHCAILRGA
ARDGMVNLEIDPAQQAGRYTLTVTPARVTVAAGDDEALCNGVQTLRQLIEGEGAALPAQQ
IEDWPDMAHRGYYFDCSRGRVPKLSYLKQVADRLCRYKINEWQLYIEHTYLFENLSEAWR
DDTPLTAQEILELDDYCAARHIELVPSLSTFGHMYKILSTKTCCDLCELPDSEKIPFSYT
YAGAHHTLNVSHPDALGFVIGLIDEYRPLFRTNKFNICDDETFDLAKGRSKALAEAEGGE
RALYVRHVKALCEHIVAQGGIPMFWGDIMWRFPESCRELPKETICLNWGYLPDQRENEIR
DIAASGITQYACPGCCGWNQWMPLLDYAYRNNRVMCRHARKYGAIGLLNTDWGDYGHIND
PRLTVPGQLYGAAFAWNADEIPFEEINEVVSRIEYRDASGRLVGAMAALADGHEIFNWAR
AVQYIEGSDETRAKILTEVDAAAIPAANEAVSAAKAQILQAARSMPVGRKEIVSLLCVVA
DGIALWNEIGAHLVQNPDDAAEGDALAGRLESWFYLYRQEWDKTSRVSATPNLIRLFCAW
ADCLRHRAYGSVHAPEVRS

Enzyme Prediction     

No EC number prediction in MGYG000000920_01722.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	128	437	1.5e-37	0.9525222551928784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	3.44e-87	129	437	1	301	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam02838	Glyco_hydro_20b	6.54e-19	2	123	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
cd02742	GH20_hexosaminidase	6.37e-17	129	436	1	297	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
COG3525	Chb	6.71e-16	3	349	136	510	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06564	GH20_DspB_LnbB-like	7.32e-15	129	327	2	201	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL14323.1	3.15e-192	1	607	1	613
VCV20393.1	7.16e-187	22	607	6	597
BCJ98685.1	1.73e-179	1	605	3	615
ABX40994.1	9.53e-171	1	605	1	602
BCJ97085.1	1.05e-163	1	605	1	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BWG_A	1.29e-14	3	366	22	388	AGlycoside Hydrolase Family 20 beta-N-Acetylglucosaminidase [Microbacterium sp. HJ5],7BWG_B A Glycoside Hydrolase Family 20 beta-N-Acetylglucosaminidase [Microbacterium sp. HJ5]
6JE8_A	1.70e-12	72	327	32	309	crystalstructure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEA_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEB_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
6Q63_A	1.86e-11	39	219	67	275	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UP57	9.95e-12	72	327	53	330	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
B2UPR7	1.92e-11	3	328	113	445	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
A6QNR0	4.98e-11	138	419	9	297	Hexosaminidase D OS=Bos taurus OX=9913 GN=HEXD PE=2 SV=2
Q8WVB3	3.27e-08	138	419	17	305	Hexosaminidase D OS=Homo sapiens OX=9606 GN=HEXD PE=1 SV=3
P49007	2.28e-07	1	213	209	444	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999950	0.000070	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000920_01722.