CAZyme Information: MGYG000000922_00224

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_00224
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000000922_2|CGC3	75333.93	4.7189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 110254; End: 112263 Strand: +

Full Sequence      

MRAQWIAYPGEFEHYHHSRISMLRRERSAPYPTFYKMDGWYTNICFSRDFCLEAPETAVV
ACEGEGYILLDGQRYPAPNPALALPAGAHRLEIRVGCLAAPPALWLESPSLASDGAWSAD
CGLAQAAPAAELPLQDPALPPSAWRLPTVRWDIASQRSLPQGLMVDLGREGMGMLAFTPL
ADGEMTLYYGESEAEALAMDEAEVYETAACRAGEPVVMPVARAMRYCLLSGVPAKDPYFL
YEVLPHERPGRFACSSSRINAIYEVAYHTMELCTREFFLDGIKRDRWLWAGDALQSVMMN
HYTFFDRDVARRTLRALRGKDPFEKHINTILDYTFYWYMAIWDDYLYTGDDSFIREMYPK
MTTALDFCLGRRNGDGFMEGQPGDWVFVDWADHLPVDGELCVEQMLLARALFIQAQAAHM
VGDAREEEYALLASQTQRRVLEVFWDEKAGVLRHYRKDGVVQPLVTRYPTLFALQFDLLP
RPAALDTARRVLLSDTVQKITTPYMRFYELDALGRLGLVKDVVREMDSYWGGMLDEGATS
FWETFDPAEADHYAMYGRPFGRSLCHCWGAGPLYLAGRYLLGVHPTEPGYARYEVEPCLG
GLEWIEGDVPTPLGKVSVRMDGEAVTVTGCGGEGRLILSGQPCPEGAQPLEDGRWSLPIG
PYETVTLKR

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	160	622	3.4e-92	0.9464285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.45e-26	247	580	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	3.28e-09	328	493	81	264	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	1.54e-06	308	447	303	464	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	0.002	582	619	1	39	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	0.003	339	429	106	194	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD84299.1	1.59e-193	1	636	1	651
AEV99890.1	4.34e-189	2	644	31	697
BAV05180.1	1.15e-187	3	669	25	711
QHS63383.1	4.30e-185	3	655	28	707
ANH83690.1	7.57e-185	5	646	24	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.72e-162	5	669	20	730	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	9.36e-36	163	614	439	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	3.36e-31	255	579	212	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.88e-06	225	390	461	651	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_00224.