CAZyme Information: MGYG000000922_00830

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_00830
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	MGYG000000922_8|CGC1	85959.69	5.163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 53757; End: 56057 Strand: -

Full Sequence      

MLESIANQLQHARWIALPDAVVQSLPRRSVSTYFRLAFTLPEDRLVTVRVSAADRYRLYV
NGQSIHAGPAKGDRWNHFYDTLQLPLLAGENILLARVMWYAPLERTVDHNQVNGPTSVMS
FQQEPLFFLESVGEGLDLSTGYAAWQACWDRATELISCPAAWQGGGVEQYDGSLACADWA
TSGGRDWPAAAVRFASGINPFGEISPLILKERPIPSLYQRPLSPIRAQPVRPGEEGLAFT
DGVATVPAGGRQVLELAFDALYTAYVKLRIQSGRGRVRLIYAESYVDEKGDKGVRDDASG
RLTGTTDVILAAGTPLAWDSFWFRTFRFIRLEVEAETELTLAMPAFLETDYPLPVSTLPT
LTPDWADQLWRISLRTLNRCMHETYEDCPYYEQLQYIMDTRLEMLFTYAVGGDTRMARRT
LWDFHCSQLPDGMLQSRYPSQYPQVIPVFSLHWIFMLEDYYTQTGDDALLKQYRSTMDGV
LDYFDRHTGASGLVEHLGYWDFGDWTPQWEERHGVPFAVDAGPCAMHNLCYAQALQAAAR
MAQPMGRPALAADYTARAQAILSGVQAQCYDTGRGLFREGPAVEEYTQHTQILAILTGLV
SGGEARALMERTLADPSLIPCSFPWMFNLIRALEAVGLYERADSQIWAVYRDMLKDHLTT
VPERPFRVRSDCHAWSALVLYELPRKWLGVQPGQPGWAEIRITPVPCGLSQCAGQVCTPK
GSVEVSWIIKDSRYSLSFTAPSVPVRVYLPDGRGFYFPDGGSHIVE

Enzyme Prediction     

No EC number prediction in MGYG000000922_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	258	742	5.5e-100	0.9583333333333334
CBM67	12	197	3.5e-18	0.9715909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.33e-21	368	685	15	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.14e-09	689	754	1	68	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS28317.1	4.09e-186	7	766	5	794
QTH43327.1	2.95e-163	12	753	9	784
BBH24613.1	4.06e-161	12	765	9	800
QUI21033.1	1.04e-160	7	725	6	733
AZN43562.1	1.88e-159	7	762	4	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	7.18e-41	189	752	375	944	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	5.01e-21	265	725	205	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_00830.