CAZyme Information: MGYG000000922_00945

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_00945
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683		76737.03	5.9021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 14507; End: 16558 Strand: +

Full Sequence      

MSEQWYSRSFRRNLVDMHIDDWNPEFLAQFDPKAYFECLKAAHIQTPMIYIHSHVGLCNW
DSATGRVHRAFAGRNKVRELFDLCHGAGMSVVAYYSLIYNNWAYDAHPDWRMLDSRGLGS
REAGADHGFMTGSRYGLVCPNNEDYRAFVKAQFAELCREYEFEGIFLDMTFWPQVCYCDS
CRARFAREEGLEIPGEVDWGNPAWRRFQQARQRWMGEFAAYCTEELKRLRPRATVEHQFS
TICHDWRYGVDEKVNLANDYTGGDLYGGFLQQSYISKIFMEATENAPFEYMTSRCDPRLT
VHTTTKSLYDLKLHNYLTLAHHGAFLVIDAIDPVGTLDPQLYSRVGQVFEESMPYEPYLK
GDMVSEAALVMSYDSKYNPDAPSAPDGRADTSHPQLEAQLGAARALKDMRVLYTVLPGNR
MERLAGKSLAMVTDAPALRPEQIDALERYVRGGGSLYISGATDPELARRLLGLEYQGMTR
ERVTYAAPTALGEGCFAPEYSAKYPINYEGRQMLVSNPQNHPVLARVALPYTDPADAGRF
ASIHSNPPGPETDYPAAVLGQVGEGKVLWLSFCPEKAQAAAPRQVTRNLIGLLHRPSLVA
TDAHPCLELTLFDDGEGYLLHAVNVQEEPALPLPAYRLTLSLPRPVKEARLAPSGEMVPV
EVAPGKITLQMPAPGMFTTVRLA

Enzyme Prediction     

No EC number prediction in MGYG000000922_00945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	31	169	6.5e-26	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.42e-08	3	174	44	205	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG1874	GanA	0.002	79	465	72	499	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
cd14745	GH66	0.003	71	168	61	164	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.
cd14791	GH36	0.005	100	178	93	161	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd03143	A4_beta-galactosidase_middle_domain	0.007	404	481	33	111	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH23071.1	3.08e-162	5	677	2	670
QNK60153.1	1.69e-133	1	682	1	690
BBD45930.1	1.82e-123	5	671	8	682
AVM44410.1	3.02e-106	10	671	17	674
BBH24081.1	7.58e-49	299	682	16	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVK_AAA	9.75e-16	10	672	32	675	ChainAAA, Alpha-L-fucosidase [Paenibacillus thiaminolyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_00945.