CAZyme Information: MGYG000000922_01788

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_01788
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000000922_24|CGC2	48456.86	4.8153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 40371; End: 41675 Strand: -

Full Sequence      

MNAKDCILEGIAPVEEALRRAGADPAMFRQCFMNTLDTTLTQREDGTSFVITGDIPAMWL
RDSTAQVMHYVRFADKPAVAELIEGLIERQMRYILLDPYANAFNLEASGAKWSEDRPAQS
PWVWERKYEIDSLCHPVQLAHAYYTCHPTTAIFTPAFRQALHRIVEVFAAEQRHETSPYW
FERDDCPPSDTLPNGGKGAPVAYTGMTWSGFRPSDDACRYGYLIPANLFACVTLRRIAAF
AQVLDDEALALQAGALHEQIERGIQAYGLVEHVNHGLIYAYETDGMGHYTLMDDANVPSL
LALPYLGVCAKDDPLYLRTRGFVLSLDNRYYYEGPHARGVGSPHTPAGYIWPIALCMQAL
TSTDETEMAALVRMLLSTHGGTGFMHESFDPANPNQYTRAWFAWANSLFGELMVSLYEQG
ILEAVVGKAQSEQA

Enzyme Prediction     

No EC number prediction in MGYG000000922_01788.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	26	413	1.5e-163	0.9825870646766169

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3538	COG3538	0.0	27	418	30	424	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
pfam06824	Glyco_hydro_125	0.0	24	413	1	415	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN43553.1	5.00e-170	27	426	1	406
AUS97899.1	1.59e-168	27	422	28	426
AIQ43219.1	2.26e-166	26	417	40	434
BBI32940.1	1.91e-165	27	420	28	424
AZI44065.1	4.26e-165	28	415	27	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RQK_A	6.10e-147	14	421	8	424	Crystalstructure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	9.35e-147	14	421	8	424	Analysisof a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
5M7I_A	3.49e-146	14	421	8	424	Crystalstructure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]
2NVP_A	1.39e-140	14	421	8	424	X-RayCrystal Structure of Protein CPF_0428 from Clostridium perfringens. Northeast Structural Genomics Consortium Target CpR63. [Clostridium perfringens]
3QPF_A	2.35e-126	3	414	4	420	Analysisof a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10449	4.11e-86	27	419	83	499	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_01788.