CAZyme Information: MGYG000000922_02183

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_02183
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000000922_36|CGC1	56644.36	4.7487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 14128; End: 15660 Strand: +

Full Sequence      

MDQKTIVMMPGEAWYGLCVWDGCQMPVTQASVYSRSLEPNPTANQSAPLFVSSRGRYLWC
DAGFTVDIRDGVIHASSRQGLIDLQEGFGTLRGAYLAAAAAHFPPQGKLPPAGFFVKPQY
NTWIELAYDQTQENVLAYARRILAEGYPAGIIMIDDGWNEAYGTWEFSTRAFPDPGAMVE
ALHQMGFEVMLWVCPFVSPDTRIGRELAEKGLLIRERSGEVAIKKWWNGYSAVLDLSHPE
AAAWMRGRLDSLMARYGVDGFKFDAGDPYFYSADHDVTYAPITENGQAAAWARLGAQYAY
NEFRACFASANLPLVQRLHDKCHEWGEPGMASLIPNQLCQGIQGYAFTCPDMVGGGMLGS
FHGDGFQLDEELFVRYAQCAALSPMIQFSAAPWRLLSAEGNRLCLEAARLHTRWAETIID
LARYASQTGEPVYRYMEYEFPGQGLEQVTDQFMLGGRLLAAPVLEKGAVTRSVRLPLGRW
RYVDGALYEGGATVTVPAPLDTLPYFILEE

Enzyme Prediction     

No EC number prediction in MGYG000000922_02183.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	122	507	7.9e-78	0.9086651053864169

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.56e-158	117	480	2	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	6.45e-53	131	507	278	664	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.24e-51	130	507	40	436	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	8.10e-35	48	507	140	617	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	2.96e-34	123	388	14	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH22021.1	5.69e-190	3	508	4	507
ASY50994.1	2.38e-189	8	506	11	508
AWS25492.1	2.38e-189	8	506	11	508
SQI03748.1	9.28e-189	8	506	11	508
AQW26139.1	4.96e-186	8	506	11	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JR6_A	7.00e-28	129	507	281	682	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	7.12e-27	129	507	281	682	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
5F7C_A	1.56e-22	120	510	312	712	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	2.55e-21	158	506	411	795	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5AED_A	7.57e-20	131	506	274	661	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	5.51e-67	102	506	300	710	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	1.52e-65	102	506	299	712	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P19965	1.33e-26	182	510	346	682	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
Q9F234	1.17e-21	130	507	272	668	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P32138	4.10e-19	131	506	274	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_02183.